SecReT6
Protein ID: 53721216
SecReT6 ID73
T6SS typei3
Gene symbol-
Locus tagBPSS0180
StrainBurkholderia pseudomallei K96243
Repliconchromosome II [GenBank: NC_006351] [Browse all T6SS(s) in this replicon]
Location [Strand]240310..241455 [+]
Producthypothetical protein
NoteTssA
UniProt IDQ63NW8
KEGG IDbps:BPSS0180
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 8.40E-21, Aligned region: 68..128
ImpA-rel_N [PF06812], Evalue: 8.40E-21, Aligned region: 140..154
ImpA-rel_N [PF06812], Evalue: 8.40E-21, Aligned region: 204..220
Protein Sequence: 381 a.a.     [Download]
>gi|53721216|ref|YP_110201.1| unnamed protein product [Burkholderia pseudomallei K96243]
MTPSRKPAGRAAAARTPKPDGWMAPVDAAAPCGADLEYDPEFVVLAAKVAPRAEAQYGDFVGSPEPVNWS
DVERDCRRLMMRSKDMRLAVLFARSRTRLAGATGLAEGIGLLAAWLAAFPDAIHPQADVDADRDAALEIR
RNALQALTDADGLLADVREIALTRSSATRLQVRDVERAFAQPRPGDALAPESVVRQLDDLHAQQPETLAG
FGDALAGLAAIDAWSGEHLGDYAPDLSALDALLRRIAGANARGDRAEAEPIAPAEADAPPASEAAAAHAH
AHAHAHAHAHAHAHASPPRRREPAAQALAAAIAGEPAAQPVDRYAARELIRQARQWFEQHEPSSPIPILL
RRAEHFVGKRYADVVQAIPAELLALWSADET
 
Nucleotide Sequence: 1146 bp     [Download]
>gi|53721039|ref|NC_006351.1|:240310-241455 Burkholderia pseudomallei K96243 chromosome 2, complete sequence
ATGACCCCCAGCAGAAAACCGGCCGGCAGGGCGGCTGCCGCGCGTACGCCGAAGCCCGACGGCTGGATGG
CGCCCGTCGATGCGGCCGCGCCGTGCGGAGCGGACCTTGAATACGATCCCGAGTTCGTCGTGCTCGCGGC
GAAGGTCGCGCCGCGCGCCGAAGCGCAGTACGGGGACTTCGTCGGCTCGCCGGAGCCGGTGAACTGGAGC
GACGTCGAGCGCGACTGCCGACGGCTGATGATGCGCAGCAAGGACATGCGCCTCGCGGTGCTGTTCGCGC
GCAGCCGCACGCGGCTTGCCGGCGCGACCGGGCTCGCGGAAGGCATTGGCTTGCTGGCCGCGTGGCTCGC
CGCGTTTCCCGATGCGATTCATCCGCAAGCCGACGTCGACGCGGACCGCGACGCGGCGCTCGAGATCCGG
CGCAACGCGCTGCAGGCGCTGACCGATGCCGACGGGCTGCTGGCGGACGTGCGCGAGATCGCGCTGACCC
GCTCGAGCGCGACGCGCCTGCAGGTGCGCGACGTGGAACGCGCGTTCGCGCAACCGCGGCCCGGCGATGC
GCTCGCGCCGGAATCGGTCGTGCGCCAGCTCGACGATTTGCACGCGCAGCAGCCGGAGACGCTCGCGGGC
TTCGGCGATGCGCTCGCGGGGCTGGCCGCGATCGACGCCTGGAGCGGCGAGCATCTCGGCGATTATGCGC
CGGACCTGTCGGCGCTCGATGCGCTGCTGCGCCGGATCGCGGGCGCGAACGCGCGCGGCGATCGCGCGGA
GGCCGAGCCGATCGCGCCGGCCGAAGCCGATGCGCCGCCAGCGAGCGAGGCGGCGGCCGCGCACGCGCAC
GCGCACGCGCACGCACACGCACACGCACACGCGCACGCACACGCATCGCCGCCGCGGCGGCGCGAGCCCG
CGGCGCAGGCACTCGCGGCTGCCATTGCGGGCGAACCGGCCGCGCAGCCGGTGGATCGTTACGCGGCGCG
CGAGCTGATCCGGCAGGCGCGCCAGTGGTTCGAGCAGCACGAGCCGAGCAGCCCGATTCCGATTCTGCTC
AGGCGCGCGGAGCATTTCGTCGGCAAGCGCTATGCGGATGTGGTGCAGGCGATTCCCGCCGAGCTGCTCG
CGCTGTGGAGCGCGGACGAAACCTGA