SecReT6
Protein ID: 53721217
SecReT6 ID73
T6SS typei3
Gene symbol-
Locus tagBPSS0181
StrainBurkholderia pseudomallei K96243
Repliconchromosome II [GenBank: NC_006351] [Browse all T6SS(s) in this replicon]
Location [Strand]241527..243854 [+]
Producthypothetical protein
NoteTssI
UniProt IDQ63NW7
KEGG IDbps:BPSS0181
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 2.50E-84, Aligned region: 36..362
Phage_GPD [PF05954], Evalue: 2.50E-84, Aligned region: 591..647
Phage_base_V [PF04717], Evalue: 1.50E-21, Aligned region: 299..316
Phage_base_V [PF04717], Evalue: 1.50E-21, Aligned region: 400..492
Protein Sequence: 775 a.a.     [Download]
>gi|53721217|ref|YP_110202.1| unnamed protein product [Burkholderia pseudomallei K96243]
MPNFSAARTVTVSGPAVPTTPVGEPALELSAIRGDETLSQIYSYTLDCLTPPDPLLAHERAANLDLKAMI
GKALTVTVQLEGMGSFVPGMPGMAGAANIGAGAREISGIVTGARFEGQLNRQCRYRLTMRPWIYLADLRS
DYRIFQNRSVDEIVDEVLNAYSYSYDKRLSGRYPKLGYQVQYGETDFAFIQRLMQEHGIYWFFEHTNQVH
RMVLVDHLGAHKPVESAAYRTLRYYPPGHKIDAEYIDRFSTEEHIRPGRWATGDFDFEKPNADLGVENAL
PRDTAHNGLERYEWPGDYTAREHGEHLARVRMEQTRARGERASGGGNVRDIVCGTTFALAGHPHASANRE
YLVIGATFEATETGGASGPGAYRIDTSFVAQPATTAFRPPRTVRKPRTRGPQTAIVTGPRGQDIWTDQYG
RVKLKFHWDRSLVDDQNSSCWVRVSYAWSGNNYGGVNIPRVGSEVVVDFEHGDPDRPLVTGQVYNALHMP
PWPLPENATQSGFMTRSPAGGGENANMLRFEDKAGEEQVKLHAERNYDVSVERDATTAVGRKHLTLVGVD
LMPVMSTRSPLERLIDLLRTGGAASPAASGQPAAASRQPSGQQQQHQQQHQQHQRQRQPYQQLKQQRQMQ
RAGGWQALAANVAKTLQEIVAVLTDPFVTASVSTVQGASTSVVFGDAKGVHVGDTVKITSGDAHSEVNGT
ASSKDVNSVSLKGTSTSLTGVSTSETGTNIVTTGLTVSTTGASVSTTGFSATETLVQVAKKTQECEFIKG
IKISM
 
Nucleotide Sequence: 2328 bp     [Download]
>gi|53721039|ref|NC_006351.1|:241527-243854 Burkholderia pseudomallei K96243 chromosome 2, complete sequence
ATGCCGAATTTTTCCGCCGCCCGCACCGTGACGGTGAGCGGCCCTGCCGTGCCGACGACTCCCGTCGGCG
AGCCCGCGCTCGAACTGAGCGCGATCCGGGGCGACGAAACGCTATCGCAGATCTATTCGTACACGCTCGA
TTGCCTGACGCCGCCGGACCCGTTGCTCGCGCACGAGCGGGCCGCGAATCTCGATCTGAAGGCGATGATC
GGCAAGGCGCTGACCGTGACCGTGCAGCTCGAAGGCATGGGCTCGTTCGTGCCCGGCATGCCGGGCATGG
CGGGCGCGGCCAATATCGGCGCGGGCGCGCGCGAGATCAGCGGCATCGTGACCGGCGCGCGCTTCGAGGG
CCAACTGAACCGGCAGTGCCGCTACCGGCTGACGATGCGGCCGTGGATCTACCTGGCCGACCTGCGCTCG
GACTACCGGATTTTCCAGAACCGGAGCGTCGACGAGATCGTCGACGAAGTGCTGAACGCGTATTCGTACT
CGTACGACAAGCGCTTGAGCGGCCGGTATCCGAAGCTCGGCTACCAGGTGCAGTACGGCGAGACCGATTT
CGCGTTCATCCAGCGGCTGATGCAGGAGCACGGCATCTACTGGTTTTTCGAGCATACGAACCAGGTGCAC
CGGATGGTGCTCGTCGATCACCTGGGCGCGCACAAGCCGGTGGAGAGCGCCGCATACCGCACGCTGCGCT
ACTACCCGCCGGGGCACAAGATCGACGCCGAGTACATCGACAGGTTCAGCACCGAGGAGCACATCCGGCC
GGGCCGCTGGGCGACGGGCGATTTCGATTTCGAGAAGCCGAACGCGGACCTGGGCGTCGAGAACGCGCTG
CCGCGGGACACCGCGCACAACGGGCTCGAACGTTACGAGTGGCCGGGCGACTACACGGCGCGCGAGCACG
GCGAGCACCTCGCGCGCGTGCGCATGGAACAGACGCGCGCGCGGGGCGAGCGCGCATCGGGCGGCGGCAA
CGTGCGCGACATCGTGTGCGGCACGACATTCGCGCTCGCGGGCCATCCGCACGCGAGCGCGAACCGCGAG
TATCTGGTGATCGGCGCGACGTTCGAGGCGACGGAGACGGGCGGCGCGTCGGGGCCGGGCGCATATCGGA
TCGACACGTCGTTCGTCGCGCAGCCGGCGACCACCGCGTTCCGGCCGCCGCGCACGGTGCGCAAGCCGCG
CACGCGCGGGCCGCAGACGGCGATCGTCACCGGCCCGCGAGGGCAGGACATCTGGACGGACCAGTACGGC
CGTGTGAAGCTGAAATTCCACTGGGACCGTTCGCTCGTCGACGATCAGAACTCGTCGTGCTGGGTGCGCG
TTTCCTATGCGTGGTCGGGCAACAATTACGGCGGCGTCAATATTCCGCGCGTGGGCTCCGAAGTGGTCGT
CGATTTCGAGCACGGCGACCCGGACCGGCCGCTCGTGACGGGGCAGGTATACAACGCGCTGCACATGCCG
CCGTGGCCGTTGCCGGAGAACGCGACGCAAAGCGGCTTCATGACGCGCTCGCCCGCGGGCGGCGGCGAGA
ACGCGAACATGCTGCGCTTCGAGGACAAGGCGGGCGAGGAGCAGGTCAAGCTGCATGCGGAGCGCAATTA
CGACGTATCGGTCGAGCGCGACGCGACGACTGCCGTCGGGCGCAAGCACCTGACGCTCGTCGGCGTCGAC
CTGATGCCGGTGATGTCGACGCGCTCGCCGCTGGAGCGGCTGATCGACCTGCTGCGCACGGGCGGCGCGG
CCAGCCCGGCGGCGTCGGGGCAGCCGGCGGCGGCTTCTCGGCAACCGTCGGGACAGCAGCAGCAACATCA
ACAGCAACACCAGCAACATCAGCGGCAACGCCAGCCCTATCAGCAGTTGAAGCAGCAGCGCCAGATGCAG
CGCGCGGGCGGATGGCAGGCGCTCGCGGCGAACGTCGCGAAGACGTTGCAGGAAATCGTGGCGGTGCTCA
CGGACCCGTTCGTCACCGCGTCGGTGAGCACCGTGCAGGGCGCGTCGACGTCCGTCGTGTTCGGCGACGC
GAAGGGCGTGCACGTGGGCGATACCGTCAAGATCACCAGCGGAGACGCGCATTCGGAGGTCAACGGCACG
GCATCGTCGAAGGACGTGAACAGTGTCTCGCTGAAGGGCACGTCGACCAGCCTGACCGGGGTCAGCACCT
CCGAAACGGGGACGAACATCGTGACGACCGGACTCACGGTATCAACGACCGGCGCGAGCGTTTCGACGAC
CGGATTCAGTGCGACCGAAACGCTCGTGCAGGTCGCCAAGAAGACGCAGGAATGCGAATTCATCAAGGGC
ATCAAGATCTCGATGTGA