SecReT6
Protein ID: 53721552
SecReT6 ID74
T6SS typei3
Gene symbol-
Locus tagBPSS0516
StrainBurkholderia pseudomallei K96243
Repliconchromosome II [GenBank: NC_006351] [Browse all T6SS(s) in this replicon]
Location [Strand]703088..703636 [+]
Producthypothetical protein
NoteTssB
UniProt IDQ63MY2
KEGG IDbps:BPSS0516
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 1.30E-54, Aligned region: 11..159
Protein Sequence: 182 a.a.     [Download]
>gi|53721552|ref|YP_110537.1| unnamed protein product [Burkholderia pseudomallei K96243]
MVRQKDGQKFIGESRAPRVQIEYDVEVYGSQKKVELPFVAGVMADLSGDNVEPLGPVEDRRFQEIDVENF
DERMAQIAPSLSYHVKNVLTNDGTLIPIDLTFTSMESFEPADVVKRIPELSTLLEARNRLKELLTYMDGK
AAAEDVIQELLKSPQWANEADAAEQSGGAGEGGDHQPEEGAK
 
Nucleotide Sequence: 549 bp     [Download]
>gi|53721039|ref|NC_006351.1|:703088-703636 Burkholderia pseudomallei K96243 chromosome 2, complete sequence
ATGGTTCGACAAAAGGATGGACAGAAATTCATCGGGGAGAGTCGTGCGCCCCGCGTGCAGATTGAATACG
ACGTGGAGGTGTACGGCTCGCAGAAGAAGGTCGAGCTGCCGTTCGTCGCGGGCGTGATGGCGGACCTGTC
GGGCGACAACGTCGAGCCGCTCGGCCCGGTCGAGGATCGGCGCTTTCAGGAGATCGACGTCGAGAACTTC
GATGAGCGCATGGCGCAGATCGCGCCGTCGCTGAGCTATCACGTGAAGAACGTGCTGACCAACGACGGCA
CGCTGATTCCGATCGATCTGACGTTCACGTCGATGGAATCGTTCGAGCCGGCGGACGTCGTCAAGCGCAT
TCCCGAGCTGTCGACGCTGCTCGAGGCGCGCAACCGGCTGAAGGAGCTGCTGACCTACATGGACGGCAAG
GCGGCGGCCGAGGACGTGATCCAGGAATTGTTGAAGAGCCCGCAGTGGGCGAACGAGGCCGACGCGGCGG
AGCAATCCGGCGGCGCCGGCGAGGGTGGAGACCATCAACCGGAAGAGGGTGCGAAATGA