SecReT6
Protein ID: 53721553
SecReT6 ID74
T6SS typei3
Gene symbol-
Locus tagBPSS0517
StrainBurkholderia pseudomallei K96243
Repliconchromosome II [GenBank: NC_006351] [Browse all T6SS(s) in this replicon]
Location [Strand]703633..705144 [+]
Producthypothetical protein
NoteTssC
UniProt IDQ63MY1
KEGG IDbps:BPSS0517
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 3.80E-183, Aligned region: 69..495
Protein Sequence: 503 a.a.     [Download]
>gi|53721553|ref|YP_110538.1| unnamed protein product [Burkholderia pseudomallei K96243]
MSMQQLESSAEKVVVDQNNVNEDLKDILRRSFRPRTNEAAEAVQNAVETLLTYARRSRVVVREDVAQTIE
QLVAELDKKISEQLTLVLHNKRFQSLEGAWRGLHYLVSNTDTSENLKIRYLNISKADLGKTLRRFKGVVW
DQSPIFKMIYEQEYGQFGGEPFGCLIGDFYFDHSMQDVSILTEMSKISAAAHAPFIAAAAPGLLQMDDWS
ELSNPRDVSKIFTATEYAFWRRLRESNDSRYLALTLPRFLARVPYGPKTQPVEEFGFEEKVDPNRAEDFC
WANSAYAMGANITRAFKTYGWCTKIRGVESGGAVEVLPKFVLPSQDREVDLHCPTEIAISDRREHELSES
GLMPLVYRKNSDTAAFIGAKTVHRPAIYEDDDATANSNLSSRLPYIFATCRFAHYLKCIVRDKIGSFKSA
EDTQRWLNDWLMNYVDGDPSISSEVTKSQRPLSAAEVVVDEIPENPGYYRAQFFLRPHFQLEGLTVSLRL
VSKLPSTKHEVTT
 
Nucleotide Sequence: 1512 bp     [Download]
>gi|53721039|ref|NC_006351.1|:703633-705144 Burkholderia pseudomallei K96243 chromosome 2, complete sequence
ATGAGTATGCAGCAGCTTGAATCGTCTGCCGAGAAGGTGGTCGTCGATCAGAACAACGTCAACGAGGATC
TGAAGGACATCCTGCGCCGCTCGTTCCGGCCGCGCACCAACGAGGCGGCCGAAGCGGTGCAGAACGCGGT
CGAGACGCTGCTCACGTATGCGCGGCGCAGCCGGGTCGTGGTTCGTGAGGATGTCGCGCAGACGATCGAG
CAGCTGGTTGCCGAGCTCGACAAGAAGATCTCCGAGCAACTGACGCTCGTGCTGCACAACAAGCGCTTTC
AGAGCCTCGAAGGCGCGTGGCGCGGATTGCACTACCTCGTGTCGAACACCGATACGAGCGAGAACCTGAA
GATCCGCTACCTGAACATCTCGAAAGCGGATCTCGGCAAGACGCTGCGGCGCTTCAAGGGCGTCGTGTGG
GATCAGAGTCCGATTTTCAAGATGATCTACGAGCAGGAGTACGGCCAGTTCGGCGGCGAGCCGTTCGGCT
GCCTGATCGGCGACTTCTATTTCGACCACAGCATGCAGGACGTGTCGATCCTCACCGAGATGTCGAAGAT
CTCGGCGGCCGCTCACGCGCCGTTCATCGCGGCCGCCGCGCCCGGCCTGCTGCAGATGGACGACTGGAGC
GAGCTGTCGAACCCGCGCGACGTGTCGAAGATCTTCACGGCGACCGAATATGCGTTCTGGCGGCGCCTGC
GCGAGAGCAACGACTCGCGCTACCTCGCGCTCACGCTGCCGCGCTTCCTCGCGCGTGTGCCGTATGGTCC
GAAGACGCAGCCTGTCGAAGAGTTCGGCTTCGAGGAGAAGGTCGACCCGAACCGCGCGGAGGATTTCTGC
TGGGCGAACTCCGCGTATGCGATGGGCGCGAACATCACGCGCGCGTTCAAGACCTACGGCTGGTGCACGA
AGATTCGCGGCGTCGAGTCGGGCGGCGCGGTCGAGGTGCTGCCGAAGTTCGTGCTGCCGTCGCAGGATCG
CGAAGTCGATCTGCATTGCCCGACCGAGATCGCGATCTCGGACCGCCGCGAGCACGAATTGTCCGAGTCG
GGCCTGATGCCGCTCGTGTATCGGAAGAATTCGGATACGGCCGCGTTCATCGGCGCGAAGACCGTGCATC
GTCCGGCGATCTACGAGGACGACGACGCGACCGCGAACTCGAACCTGTCGTCGCGGCTGCCGTACATCTT
CGCGACCTGCCGTTTCGCGCATTACCTGAAGTGCATCGTGCGCGACAAGATCGGTTCGTTCAAGTCGGCC
GAGGACACGCAGCGCTGGCTCAACGACTGGCTGATGAACTACGTGGACGGCGACCCGAGCATCTCGAGCG
AGGTGACGAAGTCGCAGCGTCCGCTGTCGGCGGCGGAGGTGGTCGTCGACGAGATTCCGGAAAACCCCGG
CTACTATCGCGCGCAGTTCTTCCTGCGCCCCCATTTCCAACTGGAGGGTTTGACCGTTTCTCTCCGGCTG
GTTTCGAAGCTTCCGTCGACCAAGCACGAGGTGACGACCTGA