SecReT6
Protein ID: 53721555
SecReT6 ID74
T6SS typei3
Gene symbol-
Locus tagBPSS0519
StrainBurkholderia pseudomallei K96243
Repliconchromosome II [GenBank: NC_006351] [Browse all T6SS(s) in this replicon]
Location [Strand]705856..706326 [+]
Producthypothetical protein
NoteTssE
UniProt IDQ63MX9
KEGG IDbps:BPSS0519
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 5.70E-11, Aligned region: 28..129
Protein Sequence: 156 a.a.     [Download]
>gi|53721555|ref|YP_110540.1| unnamed protein product [Burkholderia pseudomallei K96243]
MLWPRATTLGNTHVSDLQLYNKLSKRIRRHSLQEVVADHLVDLMNHAIRGARMRIADDSPAAHSVLNFGC
PPMQMAGATKINPVHAAAHICEVIRRFEPRVDPASTVVKPRTESRKRLAQTIYFDVSMKAREDGAELRAS
LALDYLSGYFSLADDR
 
Nucleotide Sequence: 471 bp     [Download]
>gi|53721039|ref|NC_006351.1|:705856-706326 Burkholderia pseudomallei K96243 chromosome 2, complete sequence
GTGTTGTGGCCTCGCGCCACAACACTCGGGAACACGCACGTGAGCGATCTTCAACTCTACAACAAGCTGT
CGAAACGGATTCGTCGCCATTCGCTGCAAGAGGTCGTGGCCGACCACTTGGTCGATCTGATGAATCACGC
GATCCGCGGTGCGCGCATGCGCATCGCGGACGACAGCCCGGCCGCGCATTCGGTGCTGAACTTCGGTTGT
CCGCCGATGCAGATGGCCGGTGCGACGAAGATCAATCCGGTTCATGCGGCCGCGCATATCTGCGAGGTGA
TTCGCCGCTTCGAGCCGCGCGTGGACCCTGCCAGCACGGTGGTCAAGCCGCGCACGGAGAGCCGCAAGCG
CCTCGCGCAGACGATTTATTTCGACGTGTCGATGAAGGCGCGCGAAGACGGAGCCGAACTCAGGGCGAGC
CTCGCGCTCGACTATCTGAGTGGTTATTTCAGCCTGGCGGACGACCGATGA