SecReT6
Protein ID: 53721556
SecReT6 ID74
T6SS typei3
Gene symbol-
Locus tagBPSS0520
StrainBurkholderia pseudomallei K96243
Repliconchromosome II [GenBank: NC_006351] [Browse all T6SS(s) in this replicon]
Location [Strand]706340..708202 [+]
Producthypothetical protein
NoteTssF
UniProt IDQ63MX8
KEGG IDbps:BPSS0520
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 2.60E-127, Aligned region: 3..605
Protein Sequence: 620 a.a.     [Download]
>gi|53721556|ref|YP_110541.1| unnamed protein product [Burkholderia pseudomallei K96243]
MNFLDHYNDELRQLRDAGARFSKEHPQVASALGLHPDAVTDPFVERLLEGVAYLSARVQKRLDRECAEFA
QQALGRICPLYTASTPAISTFAFHPDLGSPDAFRGNTLPRGSLIAAHLPGRKLPVMFSTAREVTLLPLRL
ASVECSRSITGLPSLLAQRLASSHAVLRFRFEIEGGASIAELAREDDGFKPLHLSVAGDLPRAYALHRAL
LADTTAWYALVSTNRGDEVLPLPMSGIRLSGVDDEEALLPEAFGGLPGLRLLREYFAQPTRLLGVYVDAL
AAIAAKAPSARAFDLFFALRDAPGDLVGDVDASQFRLFATPAINLYSKRFDPVPYDANQPEQWIPVDRMR
PAAHHLWALTEVFVCETNGRAHRARSVLETAGYEGHEGSIRYGMRREDALLVDGVRRDRFDPLASHDLIA
VSMVDDTLEPDDVATITGRALVADRDWRPSALLDAELQLLDPTAVKRIECLWPASAPRGKPSIDACWEAV
SHVGRNPLALRASQQQDVTARIVEQLLLAIDKDDALDRQRLESLRSVVLRSRFVAAGRATPTALVRATQV
EIDIAESLHADRGGWLFGRLLAQALAEAATLNDGIEIVVRLDGEAASTHTNVATRDGRLA
 
Nucleotide Sequence: 1863 bp     [Download]
>gi|53721039|ref|NC_006351.1|:706340-708202 Burkholderia pseudomallei K96243 chromosome 2, complete sequence
ATGAACTTCCTCGATCACTACAACGACGAATTGCGCCAGTTGCGCGATGCGGGCGCACGCTTCTCCAAGG
AGCACCCGCAGGTGGCCTCCGCGCTCGGGCTGCATCCGGATGCGGTCACCGATCCGTTCGTCGAGCGCCT
GCTCGAGGGCGTCGCGTACCTGTCGGCGCGCGTGCAGAAGCGGCTCGATCGCGAGTGCGCGGAGTTCGCG
CAGCAGGCGCTCGGGCGCATCTGCCCGCTCTACACGGCTTCCACGCCCGCGATCTCGACGTTCGCGTTCC
ATCCCGATCTCGGCTCGCCCGATGCGTTTCGCGGCAACACGCTGCCGCGCGGCTCGCTCATCGCCGCGCA
CCTGCCCGGGCGCAAGCTGCCGGTGATGTTCTCGACCGCGCGCGAGGTCACGCTGCTGCCGCTGCGTCTC
GCATCGGTCGAGTGCAGCCGCAGCATCACCGGGCTGCCGTCGCTGCTCGCGCAGCGGCTCGCCTCGTCGC
ACGCGGTGCTGCGCTTCAGGTTCGAGATCGAGGGCGGCGCGTCGATCGCGGAGCTCGCGCGCGAGGACGA
CGGCTTCAAGCCGCTGCATCTGAGCGTGGCGGGCGATCTGCCGCGCGCATATGCGCTGCACCGCGCGCTG
CTCGCCGACACCACCGCGTGGTACGCGCTCGTGTCGACGAACCGCGGTGACGAGGTGCTGCCGTTGCCGA
TGTCGGGCATCCGGCTGTCCGGCGTCGACGACGAGGAGGCGCTGCTGCCCGAGGCGTTCGGCGGGCTGCC
CGGCCTGCGGCTGCTGCGCGAGTACTTCGCGCAGCCCACGCGGCTGCTCGGCGTCTACGTCGACGCGCTG
GCGGCGATCGCCGCGAAGGCGCCGTCCGCGCGCGCGTTCGATCTGTTCTTCGCGTTGCGCGACGCGCCGG
GCGATCTGGTGGGCGACGTCGACGCGAGCCAGTTCCGCCTGTTCGCGACGCCGGCGATCAATCTGTATTC
CAAACGTTTCGACCCGGTGCCGTACGACGCGAATCAGCCCGAGCAGTGGATTCCCGTCGACCGGATGCGG
CCCGCCGCGCATCACCTGTGGGCGCTCACCGAGGTGTTCGTGTGCGAGACCAACGGTCGCGCACACCGCG
CGCGCTCGGTGCTCGAGACGGCGGGCTACGAAGGGCACGAAGGCTCGATCCGCTACGGCATGCGGCGCGA
GGACGCGCTGCTCGTCGACGGCGTGCGGCGCGACCGGTTCGATCCGCTCGCGAGCCACGACCTGATCGCC
GTCTCGATGGTCGACGACACGCTCGAGCCGGACGACGTCGCGACGATCACGGGCCGCGCGCTCGTGGCCG
ATCGCGACTGGCGCCCGAGCGCTCTGCTCGACGCCGAGCTGCAACTGCTCGATCCGACCGCGGTCAAGCG
CATCGAGTGCCTGTGGCCGGCGAGCGCGCCGCGCGGCAAGCCGAGCATCGACGCGTGCTGGGAGGCGGTC
TCGCACGTCGGGCGCAACCCGCTCGCGCTGCGCGCGTCGCAGCAGCAGGACGTGACGGCGCGCATCGTCG
AGCAGTTGCTGCTCGCGATCGACAAGGACGACGCGCTCGATCGCCAGCGGCTCGAGAGCCTGCGCTCGGT
CGTGCTGCGCTCGCGCTTCGTCGCGGCGGGGCGCGCCACGCCCACCGCGCTGGTGCGCGCGACACAGGTG
GAGATCGACATCGCCGAATCGCTGCACGCCGATCGCGGCGGCTGGCTGTTCGGGCGGCTGCTCGCGCAGG
CGCTCGCGGAGGCCGCCACGCTCAACGACGGCATCGAGATCGTGGTGCGCCTGGACGGCGAAGCGGCGAG
CACGCACACGAACGTCGCCACGCGCGACGGGAGGCTCGCATGA