SecReT6
Protein ID: 53721557
SecReT6 ID74
T6SS typei3
Gene symbol-
Locus tagBPSS0521
StrainBurkholderia pseudomallei K96243
Repliconchromosome II [GenBank: NC_006351] [Browse all T6SS(s) in this replicon]
Location [Strand]708199..709188 [+]
Producthypothetical protein
NoteTssG
UniProt IDQ63MX7
KEGG IDbps:BPSS0521
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 1.30E-58, Aligned region: 13..312
Protein Sequence: 329 a.a.     [Download]
>gi|53721557|ref|YP_110542.1| unnamed protein product [Burkholderia pseudomallei K96243]
MTPLERVSRALTPRRTFFELMRRVEALQRRHDGRSARKRRMPKWLRIEQPAQMHFASTEVERVQVTLARF
VEDDDHPQVTVAQRHFGLFAPYGPLPLHVTEHAMQEKRFERNAAFERFVNVACGDLAWLHYSAWSSMHPV
LGYERARNPFVERVTALADACRAQQDDGEPYGRHALACRRAFPGIYCAPRRSLADLQRLLRAYFGVALQV
VPRHGRWVPVPAAASHARRLGGWRLGARIWDVQHSIEIVVGPIEADEFYRWQRRAAAVMALSAVVTDFVD
GRIYPVIKVQVWTRPELAGRVGCMRVGVDAWSRPNRALRTLTVFESFRD
 
Nucleotide Sequence: 990 bp     [Download]
>gi|53721039|ref|NC_006351.1|:708199-709188 Burkholderia pseudomallei K96243 chromosome 2, complete sequence
ATGACGCCGCTCGAGCGCGTGAGCCGGGCGCTGACGCCGCGCCGCACGTTCTTCGAGCTGATGCGGCGCG
TCGAGGCGCTGCAGCGCAGGCACGACGGGCGTTCGGCGCGCAAGCGCCGGATGCCGAAGTGGCTGCGCAT
CGAGCAGCCGGCGCAGATGCACTTCGCGAGCACGGAAGTCGAGCGCGTGCAGGTGACGCTCGCGCGCTTC
GTCGAGGACGACGATCACCCGCAAGTCACGGTGGCGCAGCGCCATTTCGGGCTGTTCGCGCCGTACGGGC
CGCTGCCGCTGCACGTGACCGAGCACGCGATGCAGGAGAAGCGCTTCGAGCGCAACGCCGCGTTCGAGCG
CTTCGTAAACGTCGCGTGCGGCGATCTCGCGTGGCTGCATTACTCGGCGTGGTCGTCGATGCATCCGGTG
CTCGGCTACGAGCGCGCGCGCAATCCGTTCGTCGAGCGCGTGACGGCGCTCGCCGATGCGTGCCGCGCGC
AGCAGGACGACGGCGAGCCGTACGGGCGGCACGCGCTCGCATGCCGGCGCGCGTTTCCGGGCATCTACTG
CGCGCCGCGTCGCTCGCTGGCCGATCTGCAGCGGCTGCTGCGCGCGTACTTCGGCGTGGCGCTGCAGGTC
GTGCCGCGCCACGGGCGCTGGGTGCCGGTGCCGGCCGCGGCGAGCCATGCGCGGCGGCTCGGCGGCTGGC
GGCTGGGTGCGCGGATCTGGGACGTGCAGCACTCGATCGAGATCGTGGTGGGGCCGATCGAGGCGGACGA
GTTCTACCGGTGGCAACGCCGCGCGGCCGCCGTGATGGCGCTGTCGGCGGTCGTGACGGATTTCGTCGAC
GGACGGATTTACCCCGTCATCAAGGTTCAGGTGTGGACGCGCCCTGAACTCGCAGGAAGGGTTGGGTGCA
TGCGTGTCGGGGTCGACGCGTGGTCACGGCCGAATCGGGCGCTGCGCACCTTGACTGTCTTTGAATCTTT
TCGGGACTAG