SecReT6
Protein ID: 53721559
SecReT6 ID74
T6SS typei3
Gene symbol-
Locus tagBPSS0523
StrainBurkholderia pseudomallei K96243
Repliconchromosome II [GenBank: NC_006351] [Browse all T6SS(s) in this replicon]
Location [Strand]712052..714343 [+]
Producthypothetical protein
NoteTssI
UniProt IDQ63MX5
KEGG IDbps:BPSS0523
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 8.70E-71, Aligned region: 23..328
Phage_GPD [PF05954], Evalue: 8.70E-71, Aligned region: 691..717
Phage_base_V [PF04717], Evalue: 3.70E-23, Aligned region: 366..459
Protein Sequence: 763 a.a.     [Download]
>gi|53721559|ref|YP_110544.1| unnamed protein product [Burkholderia pseudomallei K96243]
MRLIELRSPLLDPDAVALSFVVHENLSQEPSYQLDLLSHDPDLDFDALLGSTLSADIDLGEGDIRTFNTH
VFGGYDTGQMSGQYTYTLELRSWLSFLAENRNSRIFQNMSVPQIVEQVFQGHQRNGYRFELEGTYEPREY
CVQFQETDLNFVKRLLEDEGIYFWVEHEPDRHVVVISDTQRFEDLPLPNDTLEYLPDGEESRAIQGREGV
QRLQRTRRIKSNNVALRDFDYHAPSNKLDSDAQQVSPPNLEGIPLEYYDYAAGYREPEQGERLARLRLEA
IQAESHTLVGEANARALATGRAFTLIGHPALGRNRRYYVTNSELTFIQDGPDSTSQGRNVAVKFRALADD
QPFRPLLTTPRPEVPGIQSATVVGPEMSEVHTDKLGRIRVHFHWDRYKTTEADASCWIRVSQAWAGKGWG
VIAMPRVGQEVLVTYVDGDLDRPLVTGIVYNGENPTPYDLPKDIRYTGLVSRSIKRAGGYQNASQITFDD
QRGAERVMIHAERDMQQTVERNSSTSIAQDLNLSVKGTSTSVVGISISFTGISVSYTGLSVSFTGVSASF
TGLSTSFTGVSTSFTGVSTSFTGVDTSFKGVSTSFTGVDTSFKGVSTSFTGVSTSLTGSSNSVTGVSNSM
TGISSSWTDVSMSTTGQSQSITGVSLSYTGTSNSMTGTSTSVTGTSTSITGTSMSNTGSSTSITGTSMST
TGSSTSVTGSSVSTTGSSVSTTGSSVSTTGSSVSTTGFSFSYTGVSYSDTGIDLKKVGMQVKS
 
Nucleotide Sequence: 2292 bp     [Download]
>gi|53721039|ref|NC_006351.1|:712052-714343 Burkholderia pseudomallei K96243 chromosome 2, complete sequence
ATGCGTCTGATCGAACTGCGCAGTCCCCTGCTGGACCCGGATGCGGTGGCGCTGAGCTTCGTGGTGCACG
AGAACCTGTCGCAGGAGCCGTCGTATCAACTGGATCTGCTGAGCCACGATCCGGATCTGGACTTCGACGC
GCTGCTCGGCTCGACGCTGTCGGCCGACATCGACCTGGGCGAAGGCGACATCCGGACGTTCAACACGCAC
GTGTTCGGCGGCTACGACACGGGGCAGATGAGCGGGCAATACACGTACACGCTGGAGCTGCGAAGCTGGC
TGTCGTTTCTCGCGGAGAACCGCAACAGCCGGATCTTCCAGAACATGAGCGTGCCGCAGATCGTCGAGCA
GGTGTTCCAGGGCCATCAGCGCAACGGCTACCGGTTCGAGCTCGAAGGTACGTACGAGCCGCGCGAGTAC
TGCGTGCAGTTTCAGGAAACGGATCTGAACTTCGTGAAGCGGCTGCTGGAGGACGAAGGGATCTACTTCT
GGGTGGAGCACGAGCCGGATCGTCATGTGGTGGTGATCTCGGACACGCAGCGGTTCGAGGATCTGCCGCT
GCCGAACGACACGCTGGAGTATCTGCCGGACGGCGAGGAGTCGCGCGCGATCCAGGGGCGCGAAGGGGTG
CAGCGGCTGCAGCGCACGCGGCGGATCAAGTCGAACAACGTCGCGCTGCGGGATTTCGACTATCACGCGC
CGTCGAACAAGCTCGACAGCGACGCGCAGCAGGTGTCGCCGCCGAACCTCGAGGGGATTCCGCTCGAGTA
TTACGACTATGCGGCGGGCTACCGCGAGCCCGAGCAGGGCGAGCGTCTCGCGCGGCTGCGGCTCGAGGCG
ATTCAGGCGGAATCACACACGCTGGTGGGCGAGGCGAACGCGCGCGCGCTGGCCACGGGCCGGGCGTTCA
CGTTGATCGGGCATCCGGCGTTGGGGCGCAATCGTCGGTACTACGTGACGAACAGCGAGCTGACGTTCAT
CCAGGACGGACCGGACAGCACGTCGCAGGGGCGCAACGTCGCGGTGAAGTTCCGCGCGCTTGCCGACGAT
CAGCCGTTTCGGCCGCTGTTGACGACGCCGCGTCCCGAAGTGCCGGGCATCCAGAGCGCGACGGTGGTGG
GTCCGGAGATGTCGGAAGTGCATACCGACAAGCTCGGGCGGATTCGCGTGCATTTCCATTGGGACCGCTA
CAAGACGACCGAGGCGGATGCGTCGTGCTGGATACGCGTGTCGCAGGCATGGGCGGGCAAGGGCTGGGGC
GTGATCGCGATGCCGCGGGTCGGGCAGGAAGTGCTCGTCACGTATGTCGACGGCGATCTCGATCGGCCGC
TCGTGACGGGCATCGTCTACAACGGCGAGAACCCGACGCCTTATGACTTGCCGAAGGACATCCGCTACAC
GGGGCTGGTGTCGCGTTCGATCAAGCGTGCGGGCGGTTATCAGAACGCGAGTCAGATCACGTTCGATGAC
CAGCGCGGCGCGGAGCGCGTGATGATCCACGCGGAGCGCGACATGCAGCAGACGGTCGAGCGCAACAGCT
CGACGTCGATCGCGCAGGATCTGAACCTGTCGGTGAAGGGCACGTCGACGTCGGTCGTCGGCATCTCGAT
CAGCTTCACGGGCATCTCGGTGTCGTACACGGGGTTGTCGGTGAGCTTCACCGGCGTGTCGGCGAGCTTC
ACGGGCTTGAGCACGTCGTTTACCGGCGTGAGCACGAGTTTCACCGGCGTGTCGACGTCGTTTACCGGCG
TCGACACCAGCTTCAAGGGCGTGTCGACGTCGTTTACCGGTGTCGATACCAGCTTCAAGGGGGTGTCGAC
TTCGTTCACGGGCGTAAGCACGAGCCTCACCGGTTCGAGCAACTCGGTGACGGGCGTATCGAACAGCATG
ACGGGCATTTCGTCATCATGGACCGACGTCAGCATGTCGACGACCGGCCAATCCCAAAGCATCACGGGGG
TATCGCTGTCGTACACGGGCACGTCGAACAGCATGACGGGCACGAGCACGTCGGTGACGGGCACCTCGAC
GAGCATCACCGGCACGTCGATGTCGAACACCGGCAGCTCGACGAGCATCACGGGCACGTCGATGTCGACG
ACGGGCAGCTCGACGAGCGTCACCGGCTCGAGCGTATCGACGACCGGCAGCTCGGTGAGCACGACGGGCT
CGAGCGTGTCGACAACGGGCAGCAGCGTGTCGACGACAGGTTTCAGCTTCTCGTACACCGGCGTCAGTTA
TTCGGACACCGGTATTGACCTGAAGAAGGTCGGCATGCAAGTGAAGAGCTGA

Protein ID: 53721560
SecReT6 ID74
T6SS typei3
Gene symbol-
Locus tagBPSS0524
StrainBurkholderia pseudomallei K96243
Repliconchromosome II [GenBank: NC_006351] [Browse all T6SS(s) in this replicon]
Location [Strand]714509..716797 [+]
Producthypothetical protein
NoteTssI
UniProt IDQ63MX4
KEGG IDbps:BPSS0524
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 2.10E-70, Aligned region: 23..327
Phage_base_V [PF04717], Evalue: 3.60E-22, Aligned region: 365..458
Protein Sequence: 762 a.a.     [Download]
>gi|53721560|ref|YP_110545.1| unnamed protein product [Burkholderia pseudomallei K96243]
MRLIELRSPLLDPDAVALSFVVHENLSQEPSYQLDLLSHDSNLDFDALLGSTLSADIDLGEGDIRTFNTH
VFGGYDTGQMSGQYTYTLELRSWLSFLAENRNSRIFQDLSVPQIVEQVFQGHQRNGYRFELEGTYEPREY
CVQFQETDLNFVKRLLEDEGIYFWVEHEPDRHVVVISDTQRFEDLPLPNDTLEYLPDGEESRAIQGREGV
QRLQRTRRIKSNNVALRDFDYHAPSKQLDSDAQVEQQSLGGIPLEYYDYAAGYRDPEQGERLARLRLEAI
QADAHALGGEANARALAVGRAFTLVGHPALSRNRRYYVTNSELTFIQDGPDSTSQGRNVAVKFRALADDQ
PFRPLLVTKRPRVPGIQSATVVGPEMSEVHTDKLGRIRVHFHWDRYKTTEADASCWIRVTQAWAGKGWGV
LAMPRVGQEVIVVYVDGDLDRPLATGIVYNGENPTPYDLPKDIRYTGLVTRSIKRAGGIPNASQLTFDDQ
HGAERVMIHAERDLQQTVERNSSTSIAQDLNLSVKGTSTSVVGISVSFTGISVSYTGLSVSFTGVSARFT
GVSTSFTGVSTSFTGVSTSFTGVDTSFTGVSTGFKGVDTSFTGVATSMVGVSTSITGSSNSVTGVSNSMT
GISSSWKDVSMSTTGQSESITGVSLSYTGTSNSMTGTSTSVTGTSTSITGTSMSNTGSSTSITGTSMSTT
GSSVSTTGSSMSATGSSVGTTGSSVSTTGSKMSVTGFSFSYTGASYEDVGVDLKKLGMQTKN
 
Nucleotide Sequence: 2289 bp     [Download]
>gi|53721039|ref|NC_006351.1|:714509-716797 Burkholderia pseudomallei K96243 chromosome 2, complete sequence
ATGCGTCTGATCGAACTGCGCAGTCCCCTGCTGGACCCGGACGCCGTCGCGCTGAGCTTCGTGGTGCATG
AGAACCTGTCGCAGGAGCCGTCGTATCAGCTCGATCTGCTGAGCCACGATTCGAATCTGGACTTCGACGC
GCTGCTCGGCTCGACGCTGTCGGCCGACATCGACCTGGGCGAAGGCGACATCCGGACGTTCAACACGCAC
GTGTTCGGCGGCTACGACACGGGGCAGATGAGCGGGCAATACACGTACACGCTGGAGCTGCGAAGCTGGT
TGTCGTTTCTCGCTGAGAACCGCAACAGCCGGATCTTCCAGGATTTGAGCGTGCCGCAGATCGTCGAGCA
GGTGTTCCAGGGCCATCAGCGCAACGGCTACCGGTTCGAGCTCGAAGGCACGTACGAGCCGCGCGAGTAC
TGCGTGCAGTTCCAGGAAACGGATCTGAACTTCGTGAAGCGGCTGCTGGAGGACGAAGGGATCTACTTCT
GGGTGGAGCACGAGCCGGACCGTCATGTGGTGGTGATCTCGGACACGCAGCGGTTCGAGGATCTGCCGCT
GCCGAACGACACGCTGGAGTATCTGCCGGACGGCGAGGAGTCGCGCGCGATCCAGGGGCGCGAAGGGGTG
CAGCGGCTGCAGCGCACGCGGCGGATCAAGTCGAACAACGTCGCGCTGCGGGATTTCGACTATCACGCGC
CGTCGAAGCAACTGGACAGCGACGCGCAGGTCGAGCAGCAGAGTCTCGGCGGCATTCCGCTCGAGTACTA
CGACTACGCGGCCGGCTACCGCGACCCCGAGCAGGGCGAGCGCCTCGCGCGGCTGCGGCTCGAAGCGATT
CAGGCTGATGCACACGCGCTCGGGGGCGAGGCGAACGCACGCGCGCTGGCGGTGGGTCGCGCGTTCACGC
TGGTCGGCCATCCGGCGCTGAGCCGCAATCGTCGGTACTACGTGACGAACAGCGAGCTGACGTTCATCCA
GGACGGACCGGACAGCACGTCGCAGGGGCGCAACGTCGCGGTGAAGTTCCGCGCGCTCGCCGACGATCAG
CCGTTTCGGCCGCTGCTCGTCACCAAGCGGCCGCGCGTGCCGGGCATCCAGAGCGCGACGGTGGTGGGCC
CGGAGATGTCGGAGGTGCATACCGACAAGCTCGGGCGGATTCGCGTGCACTTCCACTGGGACCGCTACAA
GACGACCGAGGCGGACGCGTCGTGCTGGATTCGCGTGACGCAGGCATGGGCGGGCAAGGGCTGGGGTGTG
CTCGCGATGCCGCGGGTCGGGCAGGAAGTCATCGTCGTGTATGTCGACGGCGATCTCGACCGGCCGCTCG
CGACGGGCATCGTCTACAACGGCGAAAACCCGACGCCTTATGACCTGCCGAAGGATATCCGCTACACGGG
CCTCGTCACACGCTCGATCAAGCGGGCGGGCGGCATTCCGAATGCGAGCCAACTGACGTTCGACGATCAG
CACGGCGCGGAGCGCGTGATGATCCACGCGGAGCGCGACTTGCAGCAGACGGTCGAGCGCAACAGCTCGA
CGTCGATCGCGCAGGATCTGAACCTGTCGGTGAAGGGCACGTCGACGTCGGTCGTCGGCATCTCGGTCAG
CTTCACGGGCATCTCGGTGTCGTACACGGGGTTGTCGGTGAGCTTCACCGGCGTGTCGGCGAGGTTCACG
GGCGTGAGCACGTCGTTTACCGGCGTGAGCACGAGTTTCACCGGCGTGTCGACGTCGTTTACCGGCGTCG
ATACCAGCTTCACCGGCGTCTCGACCGGATTCAAGGGCGTCGACACGAGCTTCACCGGCGTCGCGACGTC
GATGGTGGGCGTGTCGACGAGCATCACGGGCTCCAGCAATTCCGTGACGGGCGTGTCGAACAGCATGACG
GGCATCTCGTCTTCCTGGAAGGACGTGAGCATGTCGACGACCGGCCAGTCCGAAAGCATCACGGGAGTAT
CGCTGTCGTACACGGGCACGTCGAACAGCATGACGGGCACGAGCACGTCGGTGACGGGCACCTCGACGAG
CATCACCGGCACGTCGATGTCGAACACCGGCAGCTCGACGAGCATCACGGGCACATCGATGTCGACGACG
GGCAGCTCGGTGAGCACGACGGGCTCGAGCATGTCGGCCACCGGCAGTTCGGTGGGCACGACGGGCTCGA
GCGTATCGACGACGGGAAGCAAGATGTCGGTCACCGGCTTCAGCTTCTCGTATACGGGAGCGAGCTACGA
GGATGTGGGCGTCGATCTGAAAAAGCTCGGGATGCAGACGAAGAACTGA