SecReT6
Protein ID: 53721565
SecReT6 ID74
T6SS typei3
Gene symbol-
Locus tagBPSS0529
StrainBurkholderia pseudomallei K96243
Repliconchromosome II [GenBank: NC_006351] [Browse all T6SS(s) in this replicon]
Location [Strand]721244..721837 [+]
Productlipoprotein
NoteTssJ
UniProt IDQ63MW9
KEGG IDbps:BPSS0529
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 3.10E-12, Aligned region: 19..154
Protein Sequence: 197 a.a.     [Download]
>gi|53721565|ref|YP_110550.1| unnamed protein product [Burkholderia pseudomallei K96243]
MRHKMGPFKSIAAALALGVLAGCSAFSSSKPEEPRQLHVTLVGGARLNVAPTGEPRPVQTCVYVVTAADW
LPTQGGDDSSCASRGQDSTVVADSRHVIAPNQLLQFSLNLPRSGELWLVADADYARRPANYGPLRVRVEG
RGLIHMAVWLDRDGIYNALLPGPVPVGGAIAPAAVRPDEPPPERKTKITYGTRRSRQ
 
Nucleotide Sequence: 594 bp     [Download]
>gi|53721039|ref|NC_006351.1|:721244-721837 Burkholderia pseudomallei K96243 chromosome 2, complete sequence
GTGCGTCACAAGATGGGCCCCTTCAAATCGATCGCGGCGGCGCTCGCGCTCGGCGTGCTCGCCGGCTGCT
CGGCCTTCTCGTCGTCGAAGCCGGAAGAGCCGCGGCAGTTGCACGTGACGCTCGTCGGCGGCGCCCGGCT
GAACGTCGCGCCGACGGGCGAGCCGCGTCCGGTGCAGACGTGCGTGTATGTCGTGACCGCGGCCGACTGG
CTGCCGACGCAGGGCGGCGACGATTCGTCGTGCGCGTCGCGCGGGCAGGACAGCACGGTCGTCGCCGACT
CGCGGCACGTGATCGCGCCGAACCAGTTGCTGCAGTTCTCGCTGAACCTGCCGCGCTCGGGCGAGCTCTG
GCTCGTCGCCGACGCCGACTACGCGCGCCGGCCGGCGAACTACGGGCCGCTGCGCGTGCGCGTCGAGGGC
CGCGGCTTGATTCACATGGCTGTCTGGCTGGACCGCGACGGCATCTACAACGCGTTGTTGCCGGGGCCCG
TGCCCGTCGGCGGCGCGATCGCCCCGGCGGCGGTCCGCCCCGACGAGCCGCCGCCCGAGCGCAAGACGAA
AATCACCTATGGGACAAGGAGAAGCAGGCAATGA