SecReT6
Protein ID: 53721566
SecReT6 ID74
T6SS typei3
Gene symbol-
Locus tagBPSS0530
StrainBurkholderia pseudomallei K96243
Repliconchromosome II [GenBank: NC_006351] [Browse all T6SS(s) in this replicon]
Location [Strand]721834..723195 [+]
Producthypothetical protein
NoteTssK
UniProt IDQ63MW8
KEGG IDbps:BPSS0530
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 8.10E-120, Aligned region: 21..448
Protein Sequence: 453 a.a.     [Download]
>gi|53721566|ref|YP_110551.1| unnamed protein product [Burkholderia pseudomallei K96243]
MSSLPVGPVAWSDGMLIETQHFQQLERHLAHQASLRLGQTSNHGWGFTLLDLDQDGLGLGRLGLRHARGV
FQDGTAFSLPSDDPLPPPLETELAQAGDIACLALQAARTGGPEMAFGDVELASRYRAVSTEVPDLAVGLD
APGTPRRLTIETGQLVTRLCWKSQLRSDEVALPIARVAGRNASRTVSLDPRFIPPLLDTRAHLVLRSLID
ELQSTLRVRLASTSAQRVLSTGGGVADLIELLLRQAIAEYRMRLANLDAFDPLPPAMLYHELVGLLGRLS
VLPGVDEELADRELGYDHDDLQTSFEPLAMMLRQALARVIETPVLPLRFEDRGDQVHICIVDKQWNLKKL
IFAFSAAMPAEKLRQLLPQQTKLGAVEQIQKLVDLQLPGARLNALPNPPRQIPYYAQSTYFEVESTDPFW
KQTLAGSAMALRIVGDFPDLRFEAWGLRDGKVA
 
Nucleotide Sequence: 1362 bp     [Download]
>gi|53721039|ref|NC_006351.1|:721834-723195 Burkholderia pseudomallei K96243 chromosome 2, complete sequence
ATGAGTAGTCTGCCGGTAGGACCGGTCGCGTGGAGCGACGGCATGCTGATCGAGACGCAGCACTTCCAGC
AGCTCGAGCGGCATCTCGCGCATCAGGCCTCGCTGCGGCTCGGTCAGACGTCGAATCACGGCTGGGGCTT
CACGCTGCTCGATCTCGACCAGGACGGCCTGGGGCTCGGCCGGCTCGGGCTGCGCCACGCGCGCGGCGTG
TTCCAGGACGGCACCGCGTTCTCGCTGCCGTCGGACGATCCGCTGCCGCCGCCGCTGGAAACCGAGCTCG
CGCAGGCGGGCGACATCGCGTGCCTCGCGCTGCAGGCCGCGCGCACGGGCGGCCCGGAGATGGCGTTCGG
CGACGTCGAGCTGGCGTCGCGCTATCGCGCGGTGTCGACCGAGGTGCCGGATCTCGCGGTCGGGCTCGAC
GCGCCCGGCACGCCGCGGCGCCTGACGATCGAGACGGGCCAGCTCGTCACGCGCCTGTGCTGGAAGTCGC
AGCTGCGCTCGGACGAGGTCGCGCTGCCGATCGCGCGCGTGGCGGGGCGCAACGCGAGCCGCACGGTGTC
GCTGGATCCGCGCTTCATTCCGCCGCTGCTCGACACGCGCGCGCACCTGGTGCTGCGCTCGCTGATCGAC
GAGCTGCAGAGCACGCTGCGCGTGCGGCTCGCGAGCACGTCCGCGCAGCGCGTGCTGTCGACGGGCGGGG
GCGTGGCCGATCTGATCGAGCTGCTGCTGCGCCAGGCGATCGCCGAGTACCGGATGCGCTTGGCGAACCT
CGACGCGTTCGATCCGCTGCCGCCGGCGATGCTGTATCACGAGCTGGTCGGCCTGCTCGGGCGGCTGAGC
GTGCTGCCGGGCGTCGACGAGGAACTGGCCGACCGCGAGCTCGGCTACGACCACGACGATCTGCAGACGA
GCTTCGAGCCGCTCGCGATGATGCTGCGCCAGGCGCTCGCGCGCGTGATCGAGACGCCGGTGCTGCCGCT
GCGCTTCGAGGATCGCGGCGATCAGGTGCACATCTGCATCGTCGACAAGCAGTGGAACCTGAAGAAACTG
ATTTTTGCGTTTTCGGCCGCGATGCCGGCGGAGAAGCTGCGGCAACTGTTGCCGCAGCAGACGAAGCTGG
GCGCCGTCGAGCAGATCCAGAAGCTCGTGGACCTGCAACTGCCGGGCGCGCGGCTGAACGCGCTGCCCAA
TCCCCCGCGCCAGATTCCCTACTACGCCCAAAGCACGTACTTCGAAGTGGAATCGACCGATCCGTTCTGG
AAGCAGACCCTCGCCGGCTCGGCGATGGCGCTGCGCATCGTCGGCGATTTCCCCGATCTTCGCTTCGAAG
CCTGGGGGCTGAGAGACGGCAAGGTGGCGTGA