SecReT6
Protein ID: 53721567
SecReT6 ID74
T6SS typei3
Gene symbol-
Locus tagBPSS0531
StrainBurkholderia pseudomallei K96243
Repliconchromosome II [GenBank: NC_006351] [Browse all T6SS(s) in this replicon]
Location [Strand]723278..724936 [+]
Producthypothetical protein
NoteTssL
UniProt IDQ63MW7
KEGG IDbps:BPSS0531
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 1.60E-43, Aligned region: 122..317
OmpA [PF00691], Evalue: 5.00E-10, Aligned region: 376..483
Protein Sequence: 552 a.a.     [Download]
>gi|53721567|ref|YP_110552.1| unnamed protein product [Burkholderia pseudomallei K96243]
MLDRAAANPDLVTRVPTLSSLSSAAMTSSAVSTTGTTNTVASGGAAAGAPSFAPPAADAFPQADGAPRNP
AVLQFPVPGGAPAPADARVAAPVVYSAQGEQAAIMKAGLQQASWNNPFVSHALPAVLQLQRHLAAGPLNQ
AAIRTQLGLEVRLYRERLAASGCEWEQIRDASYLLCTYLDETVNDAAREHAQVVYDGERSLLVEFHDDAW
GGEDAFADLSRWMKTEPPPIPLLSFYELILSLGWQGRYRVLDRGDVLLQDLRSQLHALIWHHVPPEPLGT
ELVAPAKRRRSWWTAGRAAAVALGVLVLAYGAISFWLDSQGRPIRNALAAWMPPTRTINIAETLPPPLPQ
ILTEGWLTAYKHPQGWLLVFKSDGAFDVGKANVRADFMHNIERLGLAFAPWPGDLEVIGHTDSRPIRTSE
FPDNQALSEARARNVADELRKTALPGGARAPENAVQRNIEYSGRGDAQPIDTAKTAAAYERNRRVDVLWK
VIPDGAQQSGRSLNLQQPEKPGQVPMRPAMPEGVEIAPDGQLPYATSTTMPATRPTTEGRQP
 
Nucleotide Sequence: 1659 bp     [Download]
>gi|53721039|ref|NC_006351.1|:723278-724936 Burkholderia pseudomallei K96243 chromosome 2, complete sequence
ATGCTCGATCGCGCGGCGGCGAATCCGGATCTCGTGACGCGCGTGCCGACGCTGTCGTCGCTGTCGAGCG
CGGCGATGACGAGCTCCGCCGTATCGACCACCGGCACGACGAACACGGTGGCGTCGGGCGGCGCGGCCGC
GGGCGCGCCGAGCTTCGCGCCGCCGGCCGCCGACGCGTTTCCCCAAGCCGACGGCGCGCCCCGCAACCCC
GCGGTGCTGCAATTCCCGGTGCCGGGCGGCGCGCCCGCGCCCGCCGACGCGCGGGTGGCAGCGCCCGTCG
TCTACAGCGCGCAGGGCGAGCAGGCCGCGATCATGAAAGCAGGCCTGCAGCAGGCGAGCTGGAACAACCC
GTTCGTGTCGCACGCGCTGCCCGCGGTGCTGCAACTGCAGCGCCACCTCGCGGCCGGCCCGCTCAATCAG
GCCGCGATCCGCACGCAGCTCGGCCTCGAGGTGCGGCTCTACCGCGAGCGGCTCGCCGCCTCCGGCTGCG
AATGGGAGCAGATCCGCGACGCGTCGTACCTGCTCTGCACGTATCTCGACGAAACCGTCAACGACGCGGC
GCGCGAGCACGCGCAAGTCGTCTACGACGGCGAGCGCAGCCTGCTCGTCGAATTCCACGACGACGCGTGG
GGCGGCGAGGACGCGTTCGCCGACCTGTCGCGCTGGATGAAGACCGAGCCGCCGCCGATTCCGCTTCTGT
CGTTCTACGAACTGATCCTGTCGCTCGGCTGGCAGGGCCGCTACCGCGTGCTCGACCGCGGCGACGTGCT
GCTGCAGGATCTGCGCTCGCAACTGCACGCGCTGATCTGGCATCACGTGCCGCCCGAGCCGCTCGGCACC
GAGCTCGTCGCGCCCGCGAAGCGGCGCCGCTCGTGGTGGACGGCCGGGCGCGCGGCGGCCGTCGCGCTCG
GCGTGCTGGTGCTCGCGTACGGCGCGATCAGCTTCTGGCTCGATTCGCAGGGCCGCCCGATCCGCAACGC
GCTCGCCGCGTGGATGCCGCCCACGCGCACGATCAACATCGCCGAGACGCTGCCGCCGCCGCTGCCGCAG
ATTCTCACCGAAGGGTGGCTCACCGCGTACAAGCATCCGCAAGGATGGCTGCTCGTGTTCAAGAGCGACG
GCGCGTTCGACGTCGGCAAGGCGAACGTGCGGGCGGACTTCATGCACAACATCGAGCGGCTCGGCCTCGC
GTTCGCGCCGTGGCCGGGCGACCTCGAGGTGATCGGCCACACCGATTCGCGGCCGATCCGCACGAGCGAG
TTCCCGGACAACCAGGCGCTGTCCGAAGCGCGGGCGCGCAACGTCGCCGACGAACTGCGCAAGACCGCGC
TGCCGGGCGGCGCGCGCGCGCCGGAGAACGCGGTGCAGCGCAACATCGAGTACTCGGGGCGCGGCGACGC
GCAGCCGATCGACACCGCGAAGACGGCCGCCGCGTACGAGCGCAACCGCCGCGTCGACGTGCTGTGGAAG
GTGATTCCCGACGGCGCGCAGCAATCGGGCCGCAGCCTGAACCTGCAGCAGCCGGAGAAGCCCGGGCAGG
TGCCGATGCGTCCGGCGATGCCGGAGGGCGTGGAGATCGCGCCTGACGGGCAACTGCCGTATGCGACGTC
AACCACGATGCCAGCAACGCGACCGACCACGGAGGGCCGTCAGCCATGA