SecReT6
Protein ID: 538392457
SecReT6 ID845
T6SS typei3
Gene symbol-
Locus tagVAPA_1c02270
StrainVariovorax paradoxus B4
Repliconchromosome I [GenBank: NC_022247] [Browse all T6SS(s) in this replicon]
Location [Strand]235631..236719 [+]
Producttype VI secretion-associated protein, ImpA family
NoteTssA
UniProt IDT1X368
KEGG IDvpd:VAPA_1c02270
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 1.50E-17, Aligned region: 55..113
Protein Sequence: 362 a.a.     [Download]
>gi|538392457|ref|YP_008514030.1| type VI secretion-associated protein, ImpA family [Variovorax paradoxus B4]
MPPSEIELLQSPVEGPLPCGEDLEYDPDFMALQQAATGKREQQFGSTIIPAEPPDWARVERIAKQLCQRT
LDVRVLVLLTLAWTESRGLPGYVDGLRVVDGILQKFWNDVHPRVVDGDFEDPLPRMNALAALAEAEGLGR
SVRDARLLEDAGVSMSLRQVEALLDSSKADQIDYPGGIGRLREVARRAQEKAAPPVMALHAAIELLRRIR
ETSERALGQSWAPDFSRLERSLRTVVQLLPEQAQPEPAEALQPAAQGNGSAQAAPSARGAEGGVANGAPG
PRAASIKDIEISTRDDVQVLLEKACQYMERTEPSHPAPMLIRRAQRLLDLNFFQIIEELVPEGLQKIESL
AGRSLSGGSAAE
 
Nucleotide Sequence: 1089 bp     [Download]
>gi|538392231|ref|NC_022247.1|:235631-236719 Variovorax paradoxus B4 chromosome 1, complete sequence
TTGCCGCCGAGCGAGATCGAACTACTGCAGTCGCCTGTTGAAGGCCCGCTTCCTTGCGGTGAAGACCTCG
AATACGACCCTGATTTCATGGCGTTGCAGCAAGCTGCAACCGGAAAGCGGGAGCAGCAGTTCGGCTCGAC
CATCATTCCGGCCGAGCCGCCCGACTGGGCCCGTGTCGAGCGCATTGCCAAGCAGCTGTGCCAACGCACG
CTCGACGTGCGCGTGCTGGTTCTGCTGACGCTGGCGTGGACCGAGAGCCGAGGATTGCCGGGCTACGTCG
ATGGCTTGCGCGTGGTGGACGGCATCCTGCAAAAGTTCTGGAACGACGTCCATCCGCGCGTTGTCGATGG
CGATTTCGAAGACCCGCTGCCGCGCATGAATGCGCTGGCTGCATTGGCCGAAGCCGAGGGACTCGGACGC
AGCGTGCGCGATGCGCGCCTGCTCGAGGATGCCGGCGTGTCGATGAGCCTGCGGCAGGTCGAGGCCTTGC
TTGACTCGAGCAAGGCCGACCAGATCGATTACCCGGGTGGCATCGGCCGGCTGCGGGAGGTGGCGCGCCG
CGCGCAGGAGAAGGCGGCGCCCCCGGTGATGGCATTGCATGCGGCAATCGAACTGCTGCGGCGCATTCGA
GAGACTTCGGAGCGGGCCTTGGGACAAAGCTGGGCGCCCGATTTTTCCCGGCTCGAACGCTCGCTTCGCA
CCGTGGTCCAGTTGCTGCCGGAGCAGGCCCAGCCGGAGCCGGCCGAAGCACTGCAGCCGGCCGCGCAAGG
GAATGGATCGGCGCAGGCCGCCCCTTCCGCGCGGGGCGCCGAGGGTGGTGTGGCAAACGGCGCCCCCGGA
CCGCGGGCGGCAAGCATTAAAGATATTGAAATATCGACTCGTGATGATGTGCAGGTCTTGTTGGAAAAGG
CGTGCCAGTACATGGAACGCACGGAGCCCAGCCATCCGGCACCCATGCTCATCCGCAGAGCGCAAAGGCT
GCTGGACCTCAACTTTTTCCAGATCATCGAAGAACTCGTTCCCGAGGGCCTGCAGAAGATAGAAAGCCTG
GCCGGCCGTTCCCTGAGCGGTGGCTCCGCAGCGGAATGA