SecReT6
Protein ID: 538392458
SecReT6 ID845
T6SS typei3
Gene symbol-
Locus tagVAPA_1c02280
StrainVariovorax paradoxus B4
Repliconchromosome I [GenBank: NC_022247] [Browse all T6SS(s) in this replicon]
Location [Strand]236793..237362 [+]
Producttype VI secretion protein, VC_A0107 family
NoteTssB
UniProt IDT1X420
KEGG IDvpd:VAPA_1c02280
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 3.70E-59, Aligned region: 14..166
Protein Sequence: 189 a.a.     [Download]
>gi|538392458|ref|YP_008514031.1| type VI secretion protein, VC_A0107 family [Variovorax paradoxus B4]
MADNRVRNSGQKFIARNRAPRVQIEYDVEIYGSERKIQLPFVMGVIADLAGKQVDPMPDLADRDFMAVDI
DNFDDRMKSIKPRVAFQVPNTLTGEGQMNVDITFDSMDDFSPARIARQVGALQHLLEARTELSNLLSYMD
GKNGAEQLIAQALQNPELLKSLASAPNPAVAKAVEAANEKSGAPGTPSE
 
Nucleotide Sequence: 570 bp     [Download]
>gi|538392231|ref|NC_022247.1|:236793-237362 Variovorax paradoxus B4 chromosome 1, complete sequence
ATGGCAGACAACCGTGTCAGAAACAGTGGTCAGAAGTTCATCGCGCGAAATCGGGCACCCCGCGTGCAGA
TCGAGTACGACGTCGAGATCTACGGCAGCGAACGCAAGATCCAGCTGCCCTTCGTGATGGGCGTGATCGC
CGATCTCGCGGGCAAGCAGGTCGACCCGATGCCCGACCTCGCGGATCGCGACTTCATGGCGGTGGACATC
GACAACTTCGACGACCGCATGAAGTCGATCAAGCCGCGCGTGGCCTTCCAGGTGCCCAACACCCTCACGG
GCGAAGGACAGATGAATGTCGACATCACCTTCGACAGCATGGACGACTTCTCGCCCGCGCGCATTGCCCG
CCAGGTGGGCGCGCTGCAGCATCTGCTGGAAGCACGCACCGAGCTTTCCAACCTGCTGTCCTACATGGAC
GGCAAGAACGGCGCCGAGCAGCTGATTGCGCAGGCGCTGCAGAACCCGGAGCTGCTCAAGTCGCTGGCGT
CCGCGCCCAATCCCGCCGTTGCCAAGGCGGTCGAGGCCGCGAACGAAAAGTCGGGCGCTCCCGGCACCCC
TTCCGAGTAA