SecReT6
Protein ID: 538392459
SecReT6 ID845
T6SS typei3
Gene symbol-
Locus tagVAPA_1c02290
StrainVariovorax paradoxus B4
Repliconchromosome I [GenBank: NC_022247] [Browse all T6SS(s) in this replicon]
Location [Strand]237390..238898 [+]
Producttype VI secretion protein, EvpB/VC_A0108 family
NoteTssC
UniProt IDT1X4T9
KEGG IDvpd:VAPA_1c02290
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 2.10E-194, Aligned region: 70..495
Protein Sequence: 502 a.a.     [Download]
>gi|538392459|ref|YP_008514032.1| type VI secretion protein, EvpB/VC_A0108 family [Variovorax paradoxus B4]
MSTASKQTARGQTATIEALEPNEFSDLLQREFKPKTDQAREAVQSAVKTLAVQALESTVTISNDAYRTVQ
AIITEIDRKLSEQINQILHHEDFQQLEGAWRGLHYLVNNTETDEQLKIRVMCASKREVARSLKRHKGIGW
DQSPLFKKIYEHEYGQFGGEPFGALIGDFHFDHSPPDVEMLGEMAKIAAAAHCPFIAGASPTVMQMDSWQ
ELSNPRDLTKIFQNTEHTAWRSLRESEDARYIGLAMPRFLARLPYGARTNPVDEFEFEEETDSALHNRYT
WANSAYAMGVNINRSFKQYGWCTSIRGVESGGAVENLPTHTFPTDDGGVDMKCPTEIAISDRREAELAKN
GFMPLVHRKNSDFAAFIGAQSLQQPAEYYDADATANANLAARLPYLFACCRFAHYLKCIVRDKIGSFRER
EDMERWLNDWIMNYVDGSPGTSSQDTKAMKPLAAAEVQVEAIEDNPGYYAAKFFLRPHYQLEGLTVSLRL
VSKLPSNKKDSS
 
Nucleotide Sequence: 1509 bp     [Download]
>gi|538392231|ref|NC_022247.1|:237390-238898 Variovorax paradoxus B4 chromosome 1, complete sequence
ATGAGCACCGCATCCAAACAGACAGCGCGCGGGCAGACCGCCACCATCGAAGCACTCGAGCCGAACGAGT
TCTCCGACCTTCTGCAGCGCGAGTTCAAGCCCAAGACCGACCAGGCGCGCGAGGCGGTGCAGAGCGCCGT
CAAAACCCTTGCGGTGCAGGCGCTTGAAAGCACCGTCACCATCTCGAACGACGCCTACCGCACCGTGCAG
GCGATCATCACCGAGATCGACCGCAAGCTCTCCGAGCAGATCAACCAGATCCTCCATCACGAAGACTTCC
AGCAGCTCGAAGGCGCATGGCGCGGCCTGCACTATCTGGTCAACAACACCGAGACCGACGAGCAGCTCAA
GATCCGTGTGATGTGCGCCTCCAAGCGCGAAGTGGCGCGCTCGCTGAAGCGCCACAAGGGCATCGGCTGG
GATCAGAGCCCGCTGTTCAAGAAGATCTACGAGCACGAGTACGGCCAGTTCGGCGGCGAGCCCTTCGGCG
CGCTGATCGGCGACTTCCATTTCGATCACAGCCCGCCGGATGTGGAGATGCTCGGCGAAATGGCCAAGAT
CGCCGCGGCCGCGCACTGCCCCTTCATTGCCGGTGCATCGCCCACGGTGATGCAGATGGACTCGTGGCAG
GAACTGTCGAACCCGCGCGACCTGACCAAGATCTTCCAGAACACCGAGCACACCGCATGGCGTTCGCTGC
GCGAGTCGGAAGACGCGCGCTACATCGGCCTGGCCATGCCGCGTTTCCTGGCGCGCCTGCCCTATGGCGC
GCGCACCAATCCGGTCGACGAGTTCGAGTTCGAGGAAGAAACCGACTCGGCCCTGCACAACCGCTACACC
TGGGCCAACTCGGCCTATGCGATGGGCGTGAACATCAACCGCTCGTTCAAGCAGTACGGCTGGTGCACGT
CCATTCGCGGCGTGGAGTCGGGCGGTGCGGTCGAGAACCTGCCCACCCACACCTTCCCGACGGACGATGG
CGGCGTGGACATGAAGTGCCCCACCGAGATCGCCATCAGCGACCGGCGCGAGGCCGAACTCGCCAAGAAC
GGCTTCATGCCGCTGGTGCACCGCAAGAACTCCGATTTCGCGGCCTTCATCGGTGCGCAGTCGCTGCAGC
AGCCGGCCGAGTACTACGACGCCGATGCCACGGCCAATGCCAACCTGGCGGCGCGCCTGCCGTACCTGTT
CGCATGCTGCCGCTTCGCGCACTACCTGAAGTGCATCGTGCGCGACAAGATCGGTTCGTTCCGCGAGCGC
GAGGACATGGAGCGCTGGCTCAACGACTGGATCATGAACTACGTGGACGGCAGCCCAGGCACGTCGTCCC
AGGACACGAAGGCAATGAAGCCGCTGGCGGCGGCGGAAGTCCAGGTGGAAGCCATCGAGGACAACCCCGG
CTACTACGCCGCCAAGTTTTTTCTCCGGCCGCACTATCAGCTCGAAGGGCTGACGGTGTCACTGCGGCTG
GTTTCGAAGCTGCCATCCAACAAGAAGGACAGCAGCTAG