SecReT6
Protein ID: 538392460
SecReT6 ID845
T6SS typei3
Gene symbol-
Locus tagVAPA_1c02300
StrainVariovorax paradoxus B4
Repliconchromosome I [GenBank: NC_022247] [Browse all T6SS(s) in this replicon]
Location [Strand]238948..239430 [+]
Producthypothetical protein
NoteTssD
UniProt IDT1XJ08
KEGG IDvpd:VAPA_2c03160, vpd:VAPA_1c02300
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 1.20E-34, Aligned region: 6..136
Protein Sequence: 160 a.a.     [Download]
>gi|538392460|ref|YP_008514033.1| hypothetical protein VAPA_1c02300 [Variovorax paradoxus B4]
MAVDMFMRVEGANGESKDSNHKDWTDIKSFAWGATQPGNMVSGGGGGVGKASFNDLQVLARIDKAAPSVM
KNCASGKHLSKVEVSLCKAGGSQIEYTRVTLEEVLVTSVQYTAEQSGDAVLVQFAFQAAKVKQQYWEQTD
KGGKGAETVLAWNIKENREA
 
Nucleotide Sequence: 483 bp     [Download]
>gi|538392231|ref|NC_022247.1|:238948-239430 Variovorax paradoxus B4 chromosome 1, complete sequence
ATGGCAGTAGACATGTTCATGCGCGTCGAGGGCGCGAACGGCGAATCCAAGGACTCGAACCACAAGGACT
GGACGGATATCAAGTCGTTCGCATGGGGAGCCACGCAGCCTGGCAACATGGTCAGCGGCGGTGGGGGCGG
TGTGGGCAAGGCGAGCTTCAACGACCTGCAGGTGCTCGCGCGCATCGACAAGGCGGCGCCGTCGGTGATG
AAGAACTGCGCCAGCGGCAAGCACCTGAGCAAGGTGGAAGTGTCGTTGTGCAAGGCGGGTGGCTCGCAGA
TCGAATACACGCGCGTGACGCTGGAAGAAGTGCTGGTGACGTCGGTGCAGTACACGGCCGAGCAGAGCGG
CGATGCGGTGCTGGTGCAGTTCGCGTTCCAGGCGGCGAAGGTGAAGCAGCAGTACTGGGAGCAGACCGAC
AAGGGCGGCAAGGGCGCCGAGACCGTGCTGGCCTGGAACATCAAGGAAAACCGGGAAGCCTGA