SecReT6
Protein ID: 538392461
SecReT6 ID845
T6SS typei3
Gene symbol-
Locus tagVAPA_1c02310
StrainVariovorax paradoxus B4
Repliconchromosome I [GenBank: NC_022247] [Browse all T6SS(s) in this replicon]
Location [Strand]239537..240403 [+]
ProductImpE domain-containing protein
NoteTagJ
UniProt IDT1X4J2
KEGG IDvpd:VAPA_1c02310
PDB IDNA
Domain hit(s) vs Pfam ImpE [PF07024], Evalue: 1.60E-35, Aligned region: 158..280
TPR_19 [PF14559], Evalue: 0.00055, Aligned region: 18..63
TPR_19 [PF14559], Evalue: 0.00055, Aligned region: 114..130
TPR_11 [PF13414], Evalue: 0.0065, Aligned region: 40..64
Protein Sequence: 288 a.a.     [Download]
>gi|538392461|ref|YP_008514034.1| ImpE domain-containing protein [Variovorax paradoxus B4]
MGDGFAVLGERSVAEHTEWVQRQIRASPQNASLRLALCHFLALRGDWQRAEDQLKLAAKIDPSFAPASAT
CAMALAAERHRTEFWNGGRAPAVIAGQADWVAGLIAAAALPFEQAAEAADLREAARQEAPALQGTLSCVD
RTDSRAVQAIDGEPVETGEFAWLCDGDVRMGAVLELLTPSGYAWLPLPAVRRLKFSRPQHLVDLLWAPAE
IELHDGRGLNGLVPVRYPGALDALDDETTLGRRTDWLPLAGEDQYAGVGQRTLISEAGDHSLLDIRLVEF
APAESAAQ
 
Nucleotide Sequence: 867 bp     [Download]
>gi|538392231|ref|NC_022247.1|:239537-240403 Variovorax paradoxus B4 chromosome 1, complete sequence
ATGGGCGATGGGTTTGCAGTGCTGGGCGAGCGCTCGGTGGCCGAACACACCGAATGGGTGCAGCGGCAGA
TTCGCGCGAGTCCACAGAATGCCAGCCTGCGGCTTGCCCTGTGCCACTTTCTTGCGCTGCGGGGCGACTG
GCAGCGGGCTGAAGACCAGCTCAAGCTGGCCGCGAAGATCGATCCTTCCTTCGCTCCTGCCAGTGCCACC
TGCGCGATGGCGCTGGCCGCCGAGCGGCATCGAACCGAATTCTGGAACGGCGGCCGTGCGCCGGCCGTCA
TTGCCGGCCAGGCCGACTGGGTTGCGGGGCTGATCGCCGCCGCGGCGCTGCCGTTCGAGCAGGCCGCGGA
AGCGGCCGACCTGCGCGAAGCCGCGCGGCAGGAGGCCCCCGCATTGCAGGGCACGCTGAGCTGCGTCGAC
CGGACGGATTCGCGGGCCGTGCAGGCCATCGACGGCGAGCCGGTGGAAACCGGCGAGTTCGCCTGGCTCT
GCGATGGCGACGTGCGCATGGGCGCCGTGCTCGAACTCCTCACGCCTTCGGGCTATGCGTGGCTGCCGCT
GCCGGCGGTGCGCCGTCTCAAGTTTTCCCGTCCGCAGCATCTGGTCGACCTGCTCTGGGCGCCGGCCGAG
ATCGAGCTGCATGACGGCCGCGGACTCAACGGCCTGGTGCCGGTGCGCTATCCCGGCGCGCTCGATGCGC
TGGACGACGAAACAACCCTGGGCCGCCGCACCGACTGGCTGCCGCTGGCCGGCGAAGACCAGTATGCCGG
CGTGGGCCAGCGCACGCTGATCAGCGAAGCCGGCGACCATTCGCTGCTCGATATCCGCCTCGTCGAGTTC
GCGCCTGCCGAGAGTGCTGCGCAGTGA