SecReT6
Protein ID: 538392462
SecReT6 ID845
T6SS typei3
Gene symbol-
Locus tagVAPA_1c02320
StrainVariovorax paradoxus B4
Repliconchromosome I [GenBank: NC_022247] [Browse all T6SS(s) in this replicon]
Location [Strand]240433..240960 [+]
Productputative type VI secretion system lysozyme-like protein
NoteTssE
UniProt IDT1X371
KEGG IDvpd:VAPA_1c02320
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 1.20E-18, Aligned region: 46..151
Protein Sequence: 175 a.a.     [Download]
>gi|538392462|ref|YP_008514035.1| putative type VI secretion system lysozyme-like protein [Variovorax paradoxus B4]
MEADGDQQESVARDRLQPVLLDRLTDKQPQSRQERAGAFLMSGKLLRDSVLRDLQWLLNTTNFGADHTIN
AMPRARRSVVNYGVRGWAGGRMSEVNFADVEAAIRAAIIDFEPRIMKDSIDVRCVTDASDLEHHNLLALE
IRGTLWSVPYPIEFILRSELDLESGHMVLRPTGGL
 
Nucleotide Sequence: 528 bp     [Download]
>gi|538392231|ref|NC_022247.1|:240433-240960 Variovorax paradoxus B4 chromosome 1, complete sequence
ATGGAGGCCGATGGCGACCAGCAAGAAAGCGTTGCACGCGACCGCCTGCAGCCGGTGCTGCTCGACCGCC
TGACCGACAAGCAGCCGCAAAGCCGCCAGGAGCGCGCGGGTGCATTCCTGATGAGCGGAAAGCTGCTGCG
CGACTCGGTGCTGCGCGATCTGCAATGGCTGCTCAACACCACCAATTTCGGTGCGGACCACACCATCAAC
GCCATGCCGCGCGCGCGGCGCTCGGTCGTGAACTACGGCGTGCGCGGCTGGGCCGGCGGACGCATGTCGG
AGGTCAACTTCGCGGACGTCGAGGCCGCCATCCGCGCCGCGATCATCGACTTCGAGCCGCGCATCATGAA
AGACAGTATCGACGTGCGCTGCGTCACCGACGCCTCCGACCTCGAGCACCACAACCTGCTCGCGCTCGAG
ATCCGCGGCACGCTGTGGTCGGTGCCCTACCCGATCGAATTCATCCTGCGCTCCGAGCTCGACCTCGAGA
GCGGCCACATGGTCCTGCGCCCGACGGGAGGACTCTGA