SecReT6
Protein ID: 538392463
SecReT6 ID845
T6SS typei3
Gene symbol-
Locus tagVAPA_1c02330
StrainVariovorax paradoxus B4
Repliconchromosome I [GenBank: NC_022247] [Browse all T6SS(s) in this replicon]
Location [Strand]240961..242832 [+]
Producttype VI secretion protein, VC_A0110 family
NoteTssF
UniProt IDT1X424
KEGG IDvpd:VAPA_1c02330
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 2.60E-212, Aligned region: 5..622
Protein Sequence: 623 a.a.     [Download]
>gi|538392463|ref|YP_008514036.1| type VI secretion protein, VC_A0110 family [Variovorax paradoxus B4]
MDARLLDYYNRELTYMHELGAEFAQRYPKIAGRLGMRGIEVSDPYVERLLEGFSFLTARIQLKMDAEFPR
FSQRLLEVVYPNFLAPLPAMAVVQIDGNLNEGSLKAGYELPRHTIMRGRMIKGEQTACEFRTGHEVTLWP
IRIADAGIGPVPAEIAHAMPAVAQRAKSAITIKLEAVGGTTFAELPIDRLEFFLSGAELHALRVLELAVH
HSIGTVCRSGPGSKARIVPLGDEAIRHEGFDPEQALLPYDARSFQGYRLLHEYFAFPDRYLFFSVKNLRA
AASAMGGTTMEIVILLDRADGDLERLVDAKHFSLFCTPIINLVPRRSDRIPVGPGQHEHHAVIDRTRPRD
FEIFTVERVTGHMASGSEEREFRPFLGSFAADDGDFGAYFSLRREPRLVSDRARAQGTRTSYTGSEVYVS
LVDQHDAPFPHSLRHITIDALCTNRDLPLLLPTGLESDFSLRVSAPVRGIRILRGPSRPYPALAEGALTW
RLISHLGLNYLSLTDIDATQGAAALREMLDLYGNLADPAVRRQIQGVRSMALAPVFRRLPEPGPIVFGRG
VEIALKIDEVAFSGASPYLFGAVLEQFFSRHVSLNAFTEFALSSLQRGEIARWTPRIGRRPAV
 
Nucleotide Sequence: 1872 bp     [Download]
>gi|538392231|ref|NC_022247.1|:240961-242832 Variovorax paradoxus B4 chromosome 1, complete sequence
ATGGACGCAAGGCTGCTCGACTACTACAACCGCGAGCTCACCTACATGCACGAGCTCGGTGCCGAGTTCG
CGCAGCGCTACCCGAAGATCGCCGGGCGGCTGGGCATGCGCGGCATCGAGGTCAGCGACCCGTACGTGGA
GCGCCTGCTCGAGGGCTTCAGCTTTCTCACGGCGCGCATCCAGCTCAAGATGGACGCGGAGTTTCCGCGC
TTTTCGCAGCGGCTGCTCGAGGTGGTGTACCCCAACTTCCTCGCGCCGCTGCCCGCCATGGCCGTGGTGC
AGATCGACGGCAACCTCAATGAAGGCTCGCTGAAGGCCGGCTACGAACTGCCGCGCCACACGATCATGCG
CGGGCGCATGATCAAGGGCGAGCAGACGGCCTGCGAATTCCGCACCGGCCACGAGGTCACGCTGTGGCCC
ATCAGGATCGCGGATGCGGGCATCGGACCCGTGCCTGCAGAGATCGCGCATGCGATGCCCGCGGTGGCCC
AGCGGGCCAAGAGCGCGATCACCATCAAGCTCGAAGCCGTGGGCGGCACCACCTTCGCCGAGCTGCCGAT
CGACCGGCTCGAGTTCTTTCTTTCGGGCGCGGAGCTGCACGCGCTGCGCGTGCTCGAACTCGCGGTGCAC
CACAGCATCGGCACCGTATGCCGCAGCGGCCCGGGCAGCAAGGCGCGGATCGTTCCGCTCGGCGACGAAG
CCATTCGCCACGAGGGCTTCGATCCCGAGCAGGCGCTGCTGCCTTATGACGCGCGCTCGTTCCAGGGCTA
CCGGCTGCTGCACGAGTACTTCGCCTTCCCCGACCGCTACCTGTTCTTCAGCGTGAAGAACCTGCGCGCG
GCGGCCTCCGCCATGGGCGGCACCACGATGGAAATCGTGATCCTGCTCGACCGCGCCGACGGCGACCTGG
AGCGGCTGGTCGACGCCAAGCACTTCTCGCTGTTCTGCACGCCCATCATCAACCTGGTGCCGCGCCGCAG
CGACCGCATTCCGGTGGGCCCCGGGCAGCACGAGCACCATGCGGTGATCGACCGCACGCGTCCGCGCGAC
TTCGAGATCTTCACCGTCGAGCGCGTCACGGGCCACATGGCGAGCGGCTCGGAAGAGCGCGAGTTCAGGC
CCTTCCTGGGTTCGTTCGCCGCCGACGACGGCGACTTCGGCGCGTACTTCTCGCTGCGCCGCGAGCCGCG
CCTGGTGTCCGACCGTGCACGCGCGCAAGGCACCCGCACCAGCTACACCGGCAGCGAGGTGTACGTGTCG
CTCGTCGACCAGCACGACGCGCCCTTTCCGCACAGCCTGCGCCACATCACGATCGACGCGCTGTGCACCA
ACCGCGACCTGCCGCTGCTGCTGCCGACCGGGCTGGAGTCGGACTTCTCGCTGCGCGTGTCGGCGCCGGT
GCGCGGCATCCGCATCCTGCGCGGGCCGTCGCGGCCCTATCCCGCGCTGGCCGAAGGCGCGCTGACCTGG
CGCCTGATCAGCCACCTGGGCCTCAACTACCTGAGCCTGACCGACATCGACGCCACGCAGGGCGCGGCCG
CATTGCGCGAGATGCTCGATCTCTACGGCAACCTGGCCGACCCCGCGGTGCGCCGCCAGATCCAGGGCGT
GCGCTCGATGGCGCTGGCGCCGGTGTTCCGCCGCCTGCCCGAGCCGGGACCGATCGTCTTCGGGCGCGGG
GTGGAAATCGCGCTGAAGATCGACGAAGTGGCCTTCTCGGGAGCGAGCCCTTATCTTTTCGGCGCCGTGC
TGGAGCAGTTCTTCAGCCGGCACGTGTCGCTCAACGCGTTCACCGAGTTCGCGCTCTCCAGTCTGCAGCG
CGGCGAGATCGCGCGCTGGACGCCGCGCATCGGACGCCGCCCAGCCGTATGA