SecReT6
Protein ID: 538392464
SecReT6 ID845
T6SS typei3
Gene symbol-
Locus tagVAPA_1c02340
StrainVariovorax paradoxus B4
Repliconchromosome I [GenBank: NC_022247] [Browse all T6SS(s) in this replicon]
Location [Strand]242829..243980 [+]
Producttype VI secretion protein, VC_A0111 family
NoteTssG
UniProt IDT1X4U3
KEGG IDvpd:VAPA_1c02340
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 7.50E-112, Aligned region: 45..347
Protein Sequence: 383 a.a.     [Download]
>gi|538392464|ref|YP_008514037.1| type VI secretion protein, VC_A0111 family [Variovorax paradoxus B4]
MSMSTADLADDSQQAPPIAPEDAAARAPRRGAPEADPVLWAGLVDQPFEHDLFMLLRRLDAHGGHPLLGR
APRPLDEPLRLGQEPSMAFAPSNVSGVDVDGDGPPRISIYGFGLFGPNGPLPLHLTEYARERKRHHSDNT
LSAFADLFHHRLILLFYRAWADAQSVNSLDRPDGHRFVDYVASLMNMGQPGLKERDRIADHARTFMAGHL
VRQTRNPEGLIQILRLYFDVPVRVEEFVSDWVMLDERQVSRIGTSGRNQKLGAGATIGLAVRDAQGKFRL
ELGPLSQNEFRDFLPGSKRLQQVVDWVRQYVGIEFAWELRLVLKKQEALGMQLGSDQRLGWGSWLGTRLS
PTDAGDMLFQPEALYSRSASAASVAAEASSMAL
 
Nucleotide Sequence: 1152 bp     [Download]
>gi|538392231|ref|NC_022247.1|:242829-243980 Variovorax paradoxus B4 chromosome 1, complete sequence
ATGAGCATGAGCACAGCCGACCTCGCCGACGATTCGCAGCAGGCGCCGCCGATCGCGCCCGAGGATGCTG
CGGCACGCGCGCCGCGGCGCGGCGCTCCCGAGGCCGATCCGGTCCTGTGGGCCGGCCTGGTCGACCAGCC
TTTCGAGCACGACCTGTTCATGCTGCTGCGCCGCCTCGACGCACACGGCGGCCACCCCCTGCTGGGCCGC
GCACCGCGCCCGCTCGACGAGCCGTTGCGCCTGGGGCAGGAGCCTTCGATGGCCTTTGCGCCGTCGAACG
TCTCGGGTGTCGATGTCGACGGCGATGGCCCGCCGCGCATCTCGATCTACGGCTTCGGCCTGTTCGGCCC
CAACGGGCCGCTGCCACTGCACCTGACCGAGTACGCGCGCGAACGCAAGCGCCACCACAGCGACAACACG
CTCAGCGCCTTCGCCGACCTGTTCCACCACCGGCTCATCCTGCTGTTCTACCGGGCCTGGGCCGATGCGC
AGTCGGTCAACAGCCTGGACCGCCCCGACGGCCACCGCTTCGTCGACTATGTGGCGAGCCTCATGAACAT
GGGGCAGCCGGGGCTCAAGGAACGCGACCGCATTGCCGACCATGCGCGCACCTTCATGGCCGGGCACCTC
GTGCGCCAGACGCGCAACCCCGAGGGCCTGATCCAGATCCTCCGGCTGTACTTCGACGTGCCCGTGCGCG
TCGAGGAGTTCGTGAGCGACTGGGTGATGCTCGACGAGCGGCAGGTCAGCCGCATCGGCACTTCCGGGCG
CAACCAGAAGCTGGGCGCCGGCGCCACCATCGGCCTGGCGGTGCGCGATGCGCAGGGCAAGTTCCGCCTG
GAGCTGGGACCGCTCTCGCAGAACGAGTTTCGCGACTTCCTGCCGGGCAGCAAGCGCCTGCAGCAGGTGG
TCGACTGGGTGCGCCAGTACGTGGGCATCGAGTTTGCCTGGGAGCTGCGCCTCGTGCTCAAGAAGCAGGA
AGCCCTCGGCATGCAGCTGGGCAGCGACCAGCGCCTGGGCTGGGGAAGCTGGCTCGGCACGCGCCTCTCG
CCCACCGACGCCGGCGACATGCTGTTCCAGCCCGAAGCCCTGTATTCCCGTTCCGCTTCGGCTGCTTCCG
TGGCGGCCGAAGCCTCTTCCATGGCCTTATGA