SecReT6
Protein ID: 538392465
SecReT6 ID845
T6SS typei3
Gene symbol-
Locus tagVAPA_1c02350
StrainVariovorax paradoxus B4
Repliconchromosome I [GenBank: NC_022247] [Browse all T6SS(s) in this replicon]
Location [Strand]243977..246733 [+]
Producttype VI secretion ATPase, ClpV1 family
NoteTssH
UniProt IDT1X5B3
KEGG IDvpd:VAPA_1c02350
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 4.70E-41, Aligned region: 229..264
AAA_2 [PF07724], Evalue: 4.70E-41, Aligned region: 648..814
AAA [PF00004], Evalue: 2.70E-19, Aligned region: 231..362
AAA [PF00004], Evalue: 2.70E-19, Aligned region: 654..738
AAA_5 [PF07728], Evalue: 7.20E-15, Aligned region: 231..251
AAA_5 [PF07728], Evalue: 7.20E-15, Aligned region: 356..391
AAA_5 [PF07728], Evalue: 7.20E-15, Aligned region: 465..506
AAA_5 [PF07728], Evalue: 7.20E-15, Aligned region: 653..772
ClpB_D2-small [PF10431], Evalue: 5.70E-14, Aligned region: 821..895
AAA_16 [PF13191], Evalue: 7.50E-09, Aligned region: 36..77
AAA_16 [PF13191], Evalue: 7.50E-09, Aligned region: 208..252
AAA_16 [PF13191], Evalue: 7.50E-09, Aligned region: 269..309
AAA_16 [PF13191], Evalue: 7.50E-09, Aligned region: 644..691
AAA_16 [PF13191], Evalue: 7.50E-09, Aligned region: 810..839
Sigma54_activat [PF00158], Evalue: 3.30E-08, Aligned region: 225..253
Sigma54_activat [PF00158], Evalue: 3.30E-08, Aligned region: 652..770
AAA_22 [PF13401], Evalue: 6.30E-08, Aligned region: 231..311
AAA_22 [PF13401], Evalue: 6.30E-08, Aligned region: 360..395
AAA_22 [PF13401], Evalue: 6.30E-08, Aligned region: 652..675
AAA_22 [PF13401], Evalue: 6.30E-08, Aligned region: 715..736
AAA_19 [PF13245], Evalue: 2.30E-06, Aligned region: 230..254
AAA_19 [PF13245], Evalue: 2.30E-06, Aligned region: 373..407
AAA_19 [PF13245], Evalue: 2.30E-06, Aligned region: 651..675
AAA_18 [PF13238], Evalue: 3.70E-06, Aligned region: 231..270
AAA_18 [PF13238], Evalue: 3.70E-06, Aligned region: 654..694
AAA_17 [PF13207], Evalue: 6.20E-06, Aligned region: 231..294
AAA_17 [PF13207], Evalue: 6.20E-06, Aligned region: 468..495
AAA_17 [PF13207], Evalue: 6.20E-06, Aligned region: 652..689
AAA_25 [PF13481], Evalue: 1.60E-05, Aligned region: 229..308
AAA_25 [PF13481], Evalue: 1.60E-05, Aligned region: 629..678
AAA_25 [PF13481], Evalue: 1.60E-05, Aligned region: 828..872
Zeta_toxin [PF06414], Evalue: 2.30E-05, Aligned region: 231..253
Zeta_toxin [PF06414], Evalue: 2.30E-05, Aligned region: 317..399
Zeta_toxin [PF06414], Evalue: 2.30E-05, Aligned region: 646..703
NACHT [PF05729], Evalue: 2.90E-05, Aligned region: 231..271
NACHT [PF05729], Evalue: 2.90E-05, Aligned region: 388..413
NACHT [PF05729], Evalue: 2.90E-05, Aligned region: 653..683
IstB_IS21 [PF01695], Evalue: 5.00E-05, Aligned region: 215..250
IstB_IS21 [PF01695], Evalue: 5.00E-05, Aligned region: 653..673
Clp_N [PF02861], Evalue: 5.30E-05, Aligned region: 26..75
Arch_ATPase [PF01637], Evalue: 5.30E-05, Aligned region: 209..251
Arch_ATPase [PF01637], Evalue: 5.30E-05, Aligned region: 283..328
Arch_ATPase [PF01637], Evalue: 5.30E-05, Aligned region: 652..672
AAA_29 [PF13555], Evalue: 5.80E-05, Aligned region: 223..249
AAA_29 [PF13555], Evalue: 5.80E-05, Aligned region: 651..678
AAA_14 [PF13173], Evalue: 0.00023, Aligned region: 231..363
AAA_14 [PF13173], Evalue: 0.00023, Aligned region: 652..763
RNA_helicase [PF00910], Evalue: 0.0014, Aligned region: 232..252
RNA_helicase [PF00910], Evalue: 0.0014, Aligned region: 654..675
RNA_helicase [PF00910], Evalue: 0.0014, Aligned region: 751..772
T2SE [PF00437], Evalue: 0.0037, Aligned region: 216..251
T2SE [PF00437], Evalue: 0.0037, Aligned region: 638..730
NTPase_1 [PF03266], Evalue: 0.0063, Aligned region: 231..253
NTPase_1 [PF03266], Evalue: 0.0063, Aligned region: 282..308
NTPase_1 [PF03266], Evalue: 0.0063, Aligned region: 653..674
Hpr_kinase_C [PF07475], Evalue: 0.0073, Aligned region: 231..245
Hpr_kinase_C [PF07475], Evalue: 0.0073, Aligned region: 650..670
TIP49 [PF06068], Evalue: 0.0085, Aligned region: 231..252
TIP49 [PF06068], Evalue: 0.0085, Aligned region: 285..311
TIP49 [PF06068], Evalue: 0.0085, Aligned region: 653..689
TIP49 [PF06068], Evalue: 0.0085, Aligned region: 809..836
DUF815 [PF05673], Evalue: 0.009, Aligned region: 224..307
DUF815 [PF05673], Evalue: 0.009, Aligned region: 653..691
Protein Sequence: 918 a.a.     [Download]
>gi|538392465|ref|YP_008514038.1| type VI secretion ATPase, ClpV1 family [Variovorax paradoxus B4]
MTDIRRVSLFSKLNPMLYKALETATAFAKLRGNAYVELVHWLHQILQLQDSDLLRIVKRAGLNLDAVEQD
LVRALDRLPHGATSISDISEHVDNAVERAWVYASLRFEATSIRGAYLLAGIVKTPGLRQVLSGISREFDK
IVPDVLIAQLPAWTEGSPEDDFDAAAAPGQAAAAVSHQGEGAAAGGSALAKYASDLTAKARAGELDPVYG
RDDEIRQIIDILMRRRQNNPLLTGEAGVGKTAVVEGLASRLAAGDVPPSLKDVSLWVLDPTLLQAGAGVK
GEFEQRLRQVIDEVEKSPRPIVLFVDEVHTLVGAGGTAGTGDAANLLKPALARGRLRTIGATTWSEYKKY
IEKDPALTRRFQTIQVHEPTESKAVVMLRGISAELEKHHGVLILDAALEAAVSLSHRYIPARQLPDKAVS
LLDTACARVALSQHALPAAIEDLQRRIEVLGIESGIAGREAAIGVGEHQRVEDIAAQVAVARAELDLLEK
RRVEESVLVERIVALRKLLSPDAVPVRAEAQPDDEAEEEGDAEEEGDAEAPARAEAVLSEPERTPEEIRA
ELDQAQDRLVQLQGESPLILAAVDAQAIATVVADWTGIPIGRMVRDDAQSVLRLGEILSARVVAQPDALE
TISRRIRTARARLDNPNKPVGVFLLCGPSGVGKTETALALSEALYGGEQNLVTINMSEFQESHTVSTLKG
APPGYVGYGEGGVLTEAVRRRPYSVVLLDEIEKAHPDVHEIFFQVFDKGWMEDGEGRHIDFRNTVIIMTS
NVGTDLVMQLCEDPTLRPDPEPLAAALREPLLKVFAPALLGRLVVVPYYPLQADALHRIIRLQLDRIAAR
LDANHGIALDYNDSAVELVARRCTAIESGGRMIDAILTHTILPRLSEEVIGATVSARKLAGVRLSAANDD
FHYEFSER
 
Nucleotide Sequence: 2757 bp     [Download]
>gi|538392231|ref|NC_022247.1|:243977-246733 Variovorax paradoxus B4 chromosome 1, complete sequence
ATGACCGATATCCGCCGCGTCTCCCTTTTCTCCAAGCTGAATCCGATGCTCTACAAGGCATTGGAGACCG
CCACCGCATTCGCCAAGCTGCGCGGCAACGCCTACGTGGAGCTGGTGCACTGGCTGCACCAGATCCTGCA
ACTGCAGGACAGCGACCTGCTGCGCATCGTCAAGCGCGCCGGCCTCAACCTCGATGCGGTCGAGCAGGAC
CTCGTGCGCGCGCTCGACCGACTGCCGCACGGCGCCACGTCGATCAGCGACATTTCGGAGCACGTCGACA
ACGCCGTCGAGCGCGCCTGGGTCTATGCGAGCCTGCGCTTCGAGGCCACATCGATCCGCGGTGCCTACCT
GCTCGCGGGCATCGTCAAGACCCCGGGGCTGCGCCAGGTGCTCTCGGGCATCTCGCGCGAGTTCGACAAG
ATCGTGCCCGACGTTCTCATTGCCCAGCTTCCCGCATGGACCGAGGGCTCGCCCGAGGACGACTTCGACG
CTGCGGCCGCGCCGGGGCAAGCCGCCGCAGCAGTGTCCCACCAGGGCGAGGGCGCTGCCGCGGGCGGCTC
TGCGCTGGCCAAGTACGCGAGCGACCTCACGGCCAAGGCGCGTGCGGGCGAGCTCGATCCGGTCTACGGC
CGCGACGACGAGATCCGCCAGATCATCGACATCCTCATGCGCCGGCGGCAGAACAATCCGCTGCTCACCG
GCGAAGCGGGCGTGGGCAAGACGGCCGTGGTCGAAGGGCTGGCCTCGCGGCTCGCGGCGGGCGACGTGCC
GCCCTCGCTCAAGGATGTGTCGCTCTGGGTGCTCGACCCCACGCTGCTGCAGGCCGGCGCGGGCGTGAAG
GGTGAGTTCGAGCAGCGGCTGCGCCAGGTGATCGACGAGGTCGAGAAGAGCCCCAGGCCCATCGTGCTGT
TCGTCGACGAGGTGCACACGCTGGTCGGCGCGGGCGGCACGGCCGGCACCGGCGATGCGGCCAACCTGCT
GAAGCCGGCGCTCGCGCGCGGGCGGCTGCGCACCATCGGCGCCACCACCTGGTCCGAGTACAAGAAGTAC
ATCGAAAAGGACCCGGCGCTCACGCGGCGCTTCCAGACCATCCAGGTGCACGAGCCCACCGAGTCCAAGG
CCGTGGTCATGCTGCGCGGCATTTCGGCCGAGCTGGAGAAGCATCACGGCGTGCTCATTCTCGATGCCGC
GCTCGAAGCGGCCGTGAGCCTGTCGCACCGCTACATTCCCGCGCGCCAGCTGCCCGACAAGGCCGTGAGC
CTGCTCGACACCGCTTGCGCGCGCGTGGCCCTGAGCCAGCATGCGCTGCCCGCCGCGATCGAAGACCTGC
AGCGCCGCATCGAGGTGCTGGGCATCGAGTCGGGCATTGCCGGGCGCGAGGCGGCGATCGGCGTCGGCGA
GCACCAGCGCGTGGAGGACATTGCGGCCCAGGTGGCCGTGGCGCGGGCCGAGCTCGACCTGCTCGAGAAG
CGGCGCGTGGAAGAAAGCGTGCTCGTCGAGCGCATCGTGGCACTGCGCAAGCTGCTGTCGCCCGACGCGG
TGCCGGTGCGGGCCGAGGCGCAGCCGGATGACGAGGCCGAGGAGGAGGGCGATGCCGAGGAGGAGGGCGA
TGCCGAGGCACCGGCCCGGGCCGAGGCCGTTCTGTCCGAGCCCGAGCGAACGCCCGAAGAGATCCGCGCC
GAACTCGACCAGGCGCAGGACCGGCTCGTGCAGCTGCAGGGCGAATCCCCGCTCATCCTGGCGGCCGTCG
ACGCGCAGGCCATTGCCACCGTGGTGGCCGACTGGACCGGCATTCCGATCGGCCGCATGGTGCGCGACGA
CGCGCAGTCGGTGCTGCGCCTCGGCGAGATCCTCTCGGCCCGCGTCGTCGCGCAGCCCGATGCGCTGGAG
ACCATCTCGCGGCGCATCCGCACCGCCCGCGCGCGGCTCGACAATCCGAACAAGCCCGTCGGCGTGTTCC
TGCTGTGCGGCCCCTCGGGCGTGGGCAAGACCGAGACCGCGCTGGCGCTGTCCGAAGCGCTGTACGGCGG
CGAGCAGAACCTCGTCACCATCAACATGAGCGAGTTCCAGGAGTCGCACACCGTCTCCACGCTCAAGGGC
GCGCCGCCGGGCTACGTGGGCTACGGCGAAGGCGGCGTGCTCACCGAGGCCGTGCGCCGGCGTCCGTACA
GCGTGGTGCTGCTCGACGAAATCGAGAAGGCCCACCCCGATGTGCACGAGATCTTCTTCCAGGTGTTCGA
CAAGGGCTGGATGGAAGACGGCGAGGGCCGCCACATCGATTTCCGCAACACCGTGATCATCATGACCTCC
AACGTCGGCACCGACCTGGTCATGCAGCTGTGCGAAGACCCGACCCTGCGCCCCGACCCGGAGCCCTTGG
CGGCCGCATTGCGCGAACCGCTGCTCAAGGTGTTCGCGCCGGCGCTGCTGGGCCGGCTGGTTGTAGTGCC
TTATTACCCGTTGCAAGCCGATGCGTTGCACCGCATCATTCGCCTTCAGCTCGACCGTATTGCCGCGCGC
CTCGATGCAAACCATGGCATTGCCCTGGACTACAACGACAGCGCCGTCGAACTGGTGGCGCGCCGGTGCA
CCGCCATCGAGTCGGGCGGACGGATGATCGATGCGATCCTCACGCACACCATCCTTCCGCGGTTGAGCGA
AGAAGTCATCGGTGCCACGGTCAGTGCGCGCAAGCTCGCCGGCGTGCGGTTGAGCGCGGCGAACGACGAT
TTCCACTACGAATTTTCTGAACGCTGA