SecReT6
Protein ID: 538392466
SecReT6 ID845
T6SS typei3
Gene symbol-
Locus tagVAPA_1c02360
StrainVariovorax paradoxus B4
Repliconchromosome I [GenBank: NC_022247] [Browse all T6SS(s) in this replicon]
Location [Strand]246754..249138 [+]
Producttype VI secretion system Vgr family protein
NoteTssI
UniProt IDT1X4J5
KEGG IDvpd:VAPA_1c02360
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 4.30E-90, Aligned region: 25..328
Phage_base_V [PF04717], Evalue: 1.80E-24, Aligned region: 365..457
Protein Sequence: 794 a.a.     [Download]
>gi|538392466|ref|YP_008514039.1| type VI secretion system Vgr family protein [Variovorax paradoxus B4]
MPNRVVKAHTPLGEDQLLFRSMHGTEGLSQLFEFEVDLLSPSVSLDMKSVLGKPLSLEIQTAGEPRFLNG
QIVRFTMVGKEGGSSRYVLYRATVRPWLWYLTRTSDCKIFQNKSVVDILQEVFADYNFAFEKKLSGTYRQ
WEYCVQYQETDFAFVSRLMEHEGIYYYFKHEKGEHTLVLADDIGAHETLPGYPKISYLAADRNPDPFQEV
IDQWQVTEEIRPGTYVVDDYDFKKSKADLMGMRSQPRGNPHDTYEIYEWLGGFSEAEQGEHYSRIRLEEA
QSQAERDVGHSSVRGMAPGYRFTMQNCPRQDDNREYLIVSVSYALREGGYESGAAESHYSFSFAVQPTSY
AFRPPRVTPMTRTNGPQTATVVGRAGQEYWVDQYGRVKVQFRWDRYGKSDENSSCWVRVSSAWAGSNYGA
VNHPRKGQEVIVDFIGGHPDRPIIIGRVYNSDQMPPLELPAKVTVSGFVSRSQDGTPANANEFILDDAPG
CELVRIHAEKDFELDVEADERDTIAGDRTTVIEGADDYTTNTSLTETINGPHTVTVNEGGPQNITVNGGP
QNVKIKGGNQDVYVDGDQIIHVTGSRTDTVDSGETRTITGGLTEDITGRQKTTISAAYEETSGTKNVSVS
KGNENYWVSGDSVRIVGGASNLYSVGTVQVDTVGGINLFANSGDVNITTPDQFNVHANVISLTSDHKDIS
YTNSLKTHAGSTITTIADLSITSMTPFANSLAWANSFTFAPLSETVNAASTNIGGASADIKAFRWSNRAF
NQKQESQVSIGPIYVDIKILVLFP
 
Nucleotide Sequence: 2385 bp     [Download]
>gi|538392231|ref|NC_022247.1|:246754-249138 Variovorax paradoxus B4 chromosome 1, complete sequence
ATGCCCAACAGAGTCGTCAAAGCCCACACGCCGCTGGGAGAAGACCAGCTTCTGTTCCGCTCGATGCACG
GCACCGAGGGGTTGTCGCAGCTGTTCGAGTTCGAGGTCGACCTGTTGAGCCCGAGCGTGTCGCTCGACAT
GAAGTCGGTGCTGGGCAAGCCGCTCTCGCTCGAGATACAGACGGCGGGCGAACCTCGTTTCCTGAATGGG
CAGATCGTTCGCTTCACGATGGTCGGCAAGGAAGGGGGCTCGTCGCGCTACGTGCTGTACCGCGCCACTG
TGCGGCCCTGGCTCTGGTATCTGACGCGCACCAGCGACTGCAAGATCTTCCAGAACAAGTCGGTCGTCGA
CATCCTCCAGGAAGTGTTCGCCGACTACAACTTCGCGTTCGAGAAGAAGCTCAGCGGAACCTACCGCCAG
TGGGAGTACTGCGTGCAGTACCAGGAGACCGACTTCGCCTTCGTGAGCCGGTTGATGGAGCATGAAGGCA
TCTACTACTACTTCAAGCACGAGAAGGGCGAGCACACGCTGGTGCTTGCCGACGACATCGGCGCCCACGA
AACCCTGCCGGGCTATCCGAAGATCAGCTATCTTGCGGCCGACCGCAACCCGGACCCGTTCCAGGAGGTA
ATCGACCAGTGGCAGGTGACCGAGGAAATCCGCCCCGGCACCTATGTGGTGGACGACTACGATTTCAAGA
AGTCGAAGGCCGACCTCATGGGCATGCGCAGCCAGCCGCGCGGGAATCCTCACGACACCTACGAGATCTA
CGAATGGCTGGGCGGCTTCAGCGAGGCCGAGCAGGGCGAGCACTACTCGCGCATCCGGCTCGAAGAGGCG
CAATCGCAGGCCGAGCGCGACGTCGGCCACTCCAGCGTGCGTGGCATGGCGCCGGGCTACCGCTTCACGA
TGCAGAACTGCCCGCGGCAGGACGACAACCGCGAATACCTGATCGTGTCGGTGTCCTATGCGCTGCGCGA
AGGCGGGTATGAGAGCGGTGCGGCCGAAAGCCACTACAGCTTCAGCTTCGCGGTGCAGCCGACCTCGTAC
GCATTCCGTCCGCCGCGCGTCACGCCGATGACCCGGACCAACGGGCCGCAGACCGCGACGGTGGTGGGCA
GGGCAGGCCAGGAGTACTGGGTCGACCAATACGGCCGCGTGAAGGTGCAGTTCCGCTGGGACCGCTACGG
CAAGAGCGACGAGAACAGCTCATGCTGGGTGCGCGTTTCCAGCGCCTGGGCCGGCTCGAACTACGGCGCC
GTCAATCATCCGCGCAAGGGCCAGGAAGTGATCGTCGATTTCATCGGCGGCCATCCCGACCGGCCCATCA
TCATCGGCCGCGTCTACAACTCCGACCAGATGCCGCCGCTGGAACTGCCCGCGAAGGTTACCGTGAGCGG
CTTCGTGAGCCGCAGCCAGGACGGCACGCCGGCGAATGCCAACGAGTTCATTCTGGACGATGCGCCGGGC
TGCGAACTGGTCCGGATTCATGCCGAGAAGGATTTCGAGCTCGATGTGGAAGCGGACGAGCGCGACACCA
TCGCCGGCGATCGCACCACGGTGATCGAGGGCGCCGACGACTACACCACCAACACCTCGCTCACCGAGAC
GATCAACGGCCCGCATACCGTGACGGTCAACGAGGGGGGACCGCAGAACATCACCGTCAATGGCGGTCCG
CAGAACGTCAAGATCAAAGGTGGCAACCAAGATGTCTACGTCGATGGCGACCAGATCATTCACGTGACCG
GCAGTCGCACAGACACGGTGGACAGCGGCGAGACCCGGACGATAACTGGTGGTTTGACCGAAGATATAAC
GGGACGTCAGAAAACGACGATTTCCGCAGCATATGAAGAAACCTCAGGAACCAAGAATGTTTCGGTCAGC
AAGGGAAACGAAAACTATTGGGTGAGTGGAGACAGCGTTCGGATTGTTGGAGGCGCGTCAAATCTGTATT
CGGTCGGGACGGTTCAGGTCGACACCGTCGGCGGCATAAATCTCTTTGCGAACTCAGGCGACGTCAACAT
AACGACGCCGGATCAGTTCAACGTGCACGCGAACGTCATCAGCCTGACTTCGGACCACAAGGACATCAGT
TACACGAATTCGCTGAAGACCCATGCCGGCAGCACGATCACCACCATCGCGGACCTGTCCATCACGTCGA
TGACGCCGTTTGCAAATTCGCTGGCTTGGGCGAATTCATTTACCTTCGCACCGCTGTCGGAGACCGTCAA
CGCGGCGAGCACCAACATCGGCGGCGCCAGTGCCGACATCAAAGCCTTCCGCTGGTCGAACCGAGCTTTC
AACCAAAAACAGGAATCCCAGGTCTCGATCGGTCCAATCTACGTGGACATCAAGATTCTGGTGCTCTTTC
CGTGA