SecReT6
Protein ID: 538392466
SecReT6 ID845
T6SS typei3
Gene symbol-
Locus tagVAPA_1c02360
StrainVariovorax paradoxus B4
Repliconchromosome I [GenBank: NC_022247] [Browse all T6SS(s) in this replicon]
Location [Strand]246754..249138 [+]
Producttype VI secretion system Vgr family protein
NoteTssI
UniProt IDT1X4J5
KEGG IDvpd:VAPA_1c02360
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 4.30E-90, Aligned region: 25..328
Phage_base_V [PF04717], Evalue: 1.80E-24, Aligned region: 365..457
Protein Sequence: 794 a.a.     [Download]
>gi|538392466|ref|YP_008514039.1| type VI secretion system Vgr family protein [Variovorax paradoxus B4]
MPNRVVKAHTPLGEDQLLFRSMHGTEGLSQLFEFEVDLLSPSVSLDMKSVLGKPLSLEIQTAGEPRFLNG
QIVRFTMVGKEGGSSRYVLYRATVRPWLWYLTRTSDCKIFQNKSVVDILQEVFADYNFAFEKKLSGTYRQ
WEYCVQYQETDFAFVSRLMEHEGIYYYFKHEKGEHTLVLADDIGAHETLPGYPKISYLAADRNPDPFQEV
IDQWQVTEEIRPGTYVVDDYDFKKSKADLMGMRSQPRGNPHDTYEIYEWLGGFSEAEQGEHYSRIRLEEA
QSQAERDVGHSSVRGMAPGYRFTMQNCPRQDDNREYLIVSVSYALREGGYESGAAESHYSFSFAVQPTSY
AFRPPRVTPMTRTNGPQTATVVGRAGQEYWVDQYGRVKVQFRWDRYGKSDENSSCWVRVSSAWAGSNYGA
VNHPRKGQEVIVDFIGGHPDRPIIIGRVYNSDQMPPLELPAKVTVSGFVSRSQDGTPANANEFILDDAPG
CELVRIHAEKDFELDVEADERDTIAGDRTTVIEGADDYTTNTSLTETINGPHTVTVNEGGPQNITVNGGP
QNVKIKGGNQDVYVDGDQIIHVTGSRTDTVDSGETRTITGGLTEDITGRQKTTISAAYEETSGTKNVSVS
KGNENYWVSGDSVRIVGGASNLYSVGTVQVDTVGGINLFANSGDVNITTPDQFNVHANVISLTSDHKDIS
YTNSLKTHAGSTITTIADLSITSMTPFANSLAWANSFTFAPLSETVNAASTNIGGASADIKAFRWSNRAF
NQKQESQVSIGPIYVDIKILVLFP
 
Nucleotide Sequence: 2385 bp     [Download]
>gi|538392231|ref|NC_022247.1|:246754-249138 Variovorax paradoxus B4 chromosome 1, complete sequence
ATGCCCAACAGAGTCGTCAAAGCCCACACGCCGCTGGGAGAAGACCAGCTTCTGTTCCGCTCGATGCACG
GCACCGAGGGGTTGTCGCAGCTGTTCGAGTTCGAGGTCGACCTGTTGAGCCCGAGCGTGTCGCTCGACAT
GAAGTCGGTGCTGGGCAAGCCGCTCTCGCTCGAGATACAGACGGCGGGCGAACCTCGTTTCCTGAATGGG
CAGATCGTTCGCTTCACGATGGTCGGCAAGGAAGGGGGCTCGTCGCGCTACGTGCTGTACCGCGCCACTG
TGCGGCCCTGGCTCTGGTATCTGACGCGCACCAGCGACTGCAAGATCTTCCAGAACAAGTCGGTCGTCGA
CATCCTCCAGGAAGTGTTCGCCGACTACAACTTCGCGTTCGAGAAGAAGCTCAGCGGAACCTACCGCCAG
TGGGAGTACTGCGTGCAGTACCAGGAGACCGACTTCGCCTTCGTGAGCCGGTTGATGGAGCATGAAGGCA
TCTACTACTACTTCAAGCACGAGAAGGGCGAGCACACGCTGGTGCTTGCCGACGACATCGGCGCCCACGA
AACCCTGCCGGGCTATCCGAAGATCAGCTATCTTGCGGCCGACCGCAACCCGGACCCGTTCCAGGAGGTA
ATCGACCAGTGGCAGGTGACCGAGGAAATCCGCCCCGGCACCTATGTGGTGGACGACTACGATTTCAAGA
AGTCGAAGGCCGACCTCATGGGCATGCGCAGCCAGCCGCGCGGGAATCCTCACGACACCTACGAGATCTA
CGAATGGCTGGGCGGCTTCAGCGAGGCCGAGCAGGGCGAGCACTACTCGCGCATCCGGCTCGAAGAGGCG
CAATCGCAGGCCGAGCGCGACGTCGGCCACTCCAGCGTGCGTGGCATGGCGCCGGGCTACCGCTTCACGA
TGCAGAACTGCCCGCGGCAGGACGACAACCGCGAATACCTGATCGTGTCGGTGTCCTATGCGCTGCGCGA
AGGCGGGTATGAGAGCGGTGCGGCCGAAAGCCACTACAGCTTCAGCTTCGCGGTGCAGCCGACCTCGTAC
GCATTCCGTCCGCCGCGCGTCACGCCGATGACCCGGACCAACGGGCCGCAGACCGCGACGGTGGTGGGCA
GGGCAGGCCAGGAGTACTGGGTCGACCAATACGGCCGCGTGAAGGTGCAGTTCCGCTGGGACCGCTACGG
CAAGAGCGACGAGAACAGCTCATGCTGGGTGCGCGTTTCCAGCGCCTGGGCCGGCTCGAACTACGGCGCC
GTCAATCATCCGCGCAAGGGCCAGGAAGTGATCGTCGATTTCATCGGCGGCCATCCCGACCGGCCCATCA
TCATCGGCCGCGTCTACAACTCCGACCAGATGCCGCCGCTGGAACTGCCCGCGAAGGTTACCGTGAGCGG
CTTCGTGAGCCGCAGCCAGGACGGCACGCCGGCGAATGCCAACGAGTTCATTCTGGACGATGCGCCGGGC
TGCGAACTGGTCCGGATTCATGCCGAGAAGGATTTCGAGCTCGATGTGGAAGCGGACGAGCGCGACACCA
TCGCCGGCGATCGCACCACGGTGATCGAGGGCGCCGACGACTACACCACCAACACCTCGCTCACCGAGAC
GATCAACGGCCCGCATACCGTGACGGTCAACGAGGGGGGACCGCAGAACATCACCGTCAATGGCGGTCCG
CAGAACGTCAAGATCAAAGGTGGCAACCAAGATGTCTACGTCGATGGCGACCAGATCATTCACGTGACCG
GCAGTCGCACAGACACGGTGGACAGCGGCGAGACCCGGACGATAACTGGTGGTTTGACCGAAGATATAAC
GGGACGTCAGAAAACGACGATTTCCGCAGCATATGAAGAAACCTCAGGAACCAAGAATGTTTCGGTCAGC
AAGGGAAACGAAAACTATTGGGTGAGTGGAGACAGCGTTCGGATTGTTGGAGGCGCGTCAAATCTGTATT
CGGTCGGGACGGTTCAGGTCGACACCGTCGGCGGCATAAATCTCTTTGCGAACTCAGGCGACGTCAACAT
AACGACGCCGGATCAGTTCAACGTGCACGCGAACGTCATCAGCCTGACTTCGGACCACAAGGACATCAGT
TACACGAATTCGCTGAAGACCCATGCCGGCAGCACGATCACCACCATCGCGGACCTGTCCATCACGTCGA
TGACGCCGTTTGCAAATTCGCTGGCTTGGGCGAATTCATTTACCTTCGCACCGCTGTCGGAGACCGTCAA
CGCGGCGAGCACCAACATCGGCGGCGCCAGTGCCGACATCAAAGCCTTCCGCTGGTCGAACCGAGCTTTC
AACCAAAAACAGGAATCCCAGGTCTCGATCGGTCCAATCTACGTGGACATCAAGATTCTGGTGCTCTTTC
CGTGA

Protein ID: 538392494
SecReT6 ID845
T6SS typei3
Gene symbol-
Locus tagVAPA_1c02640
StrainVariovorax paradoxus B4
Repliconchromosome I [GenBank: NC_022247] [Browse all T6SS(s) in this replicon]
Location [Strand]281217..281744 [-]
Producthypothetical protein
NoteTssI
UniProt IDT1X4X3
KEGG IDvpd:VAPA_1c02640
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 175 a.a.     [Download]
>gi|538392494|ref|YP_008514067.1| hypothetical protein VAPA_1c02640 [Variovorax paradoxus B4]
MHANDRRANPPALPSLQGDALLEELIAKPADKPERRGAQGIVLGTLVDLGVEGAEKAVPRVRLAGMGTMD
VLCSLVPLAATDVGSTVALGFSGVDMRQAIILGLVWEPQEQRPPAPAVPRGDGRVVIEATNEIELRCGES
ALILSADGRIQLRGHYITSHASATQRILGGSVNVN
 
Nucleotide Sequence: 528 bp     [Download]
>gi|538392231|ref|NC_022247.1|:c281744-281217 Variovorax paradoxus B4 chromosome 1, complete sequence
GTGCACGCCAACGACCGTCGCGCCAATCCGCCCGCGTTGCCATCGCTTCAGGGCGATGCGCTGCTCGAGG
AGCTGATTGCAAAGCCCGCCGACAAGCCAGAGCGCCGTGGCGCGCAGGGCATCGTGCTCGGCACGTTGGT
CGATCTGGGTGTCGAAGGTGCGGAGAAGGCCGTGCCGCGCGTGCGCCTGGCCGGCATGGGCACGATGGAC
GTGCTGTGTTCGCTGGTGCCGCTGGCCGCGACCGATGTAGGAAGCACGGTGGCACTGGGTTTCAGTGGCG
TCGACATGCGCCAGGCCATCATCCTGGGCCTTGTGTGGGAGCCGCAGGAGCAAAGACCACCAGCACCAGC
CGTGCCGCGCGGCGACGGGCGCGTTGTCATCGAAGCAACAAATGAGATCGAACTGCGCTGCGGCGAGTCG
GCACTCATCCTCTCGGCTGACGGTCGCATCCAGCTGCGCGGTCACTACATCACCAGCCATGCCAGCGCGA
CTCAGCGCATTCTGGGCGGCTCGGTCAACGTCAATTGA

Protein ID: 538392495
SecReT6 ID845
T6SS typei3
Gene symbol-
Locus tagVAPA_1c02650
StrainVariovorax paradoxus B4
Repliconchromosome I [GenBank: NC_022247] [Browse all T6SS(s) in this replicon]
Location [Strand]281747..284032 [-]
Producttype VI secretion system protein, Vgr family
NoteTssI
UniProt IDT1X5E4
KEGG IDvpd:VAPA_1c02650
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 6.90E-72, Aligned region: 37..351
Phage_base_V [PF04717], Evalue: 2.20E-26, Aligned region: 389..482
Gp5_C [PF06715], Evalue: 8.60E-20, Aligned region: 534..553
Gp5_C [PF06715], Evalue: 8.60E-20, Aligned region: 550..571
Gp5_C [PF06715], Evalue: 8.60E-20, Aligned region: 565..587
Gp5_C [PF06715], Evalue: 8.60E-20, Aligned region: 573..596
Gp5_C [PF06715], Evalue: 8.60E-20, Aligned region: 590..612
Gp5_C [PF06715], Evalue: 8.60E-20, Aligned region: 614..628
Gp5_C [PF06715], Evalue: 8.60E-20, Aligned region: 630..651
Protein Sequence: 761 a.a.     [Download]
>gi|538392495|ref|YP_008514068.1| type VI secretion system protein, Vgr family [Variovorax paradoxus B4]
MPTGTAQLARVLSVSSSAMPMLGGEPALEPIAIEGDEGLSRLFHYTLTLATPEQPGYNERQAANVAIKQL
VGEALTAHIVLDGRPGSGPQRRHLSGLVTRVRFLRLENRRALYEAVIEPWLTLGTRTSDYRIFQNQNVLD
IVREVLGKYGLPFDVRAVRSYPPREFQVQYGESDYDFVARLLHEWGLYFYFEHEESSHKLVIVDDMASHQ
PFAHAGYQRIPFHAAEATVREEHCDRFNACEALQSGRWVIGDFDFKRPKAELQQVSAMPRKTAQNTWERY
GWPGDYVVESEGEQLVRTRMEETGSQGERAGGSGNLRAVVPGCLVTLERHPQNESNREYLVTDARLRLQD
VGDASAQQEFECRVDFEVIPTSKVFRASAPPVPRPRTTGPQTAIVTGPAGREIWTDEYGRVKLSFHWNRY
CTKDENSSCWVRVSSPWAGTNFGGIQIPRIGQEVIVDFENGDPDRPIVTGRVYNADNMPPWTLPDNATQS
GLLTRSSEGATDANANALRFEDKKGQEQLWLHAERNQDIEVERDETHWVGNDRTKTIDRDETVHVKHDRT
ETVDHDETITVHNNRTETVDGNETITIHKNRTETVDLDETITVHKNRTETVDLNETIGIGMNRTETVGMN
ETIDIGDNRVVTIGGNKAETVALAKAETIGLAKALTIGLGYQVSVGAAMNTSVALMQTEQVGRSKRVDVR
NTFDITAGDEFSITVGKSTLVMKSDGTITFNGHTFNVGTSGEQYFNADGHITSKANKIQEN
 
Nucleotide Sequence: 2286 bp     [Download]
>gi|538392231|ref|NC_022247.1|:c284032-281747 Variovorax paradoxus B4 chromosome 1, complete sequence
ATGCCAACAGGCACCGCACAGCTTGCGCGCGTTCTCAGCGTTTCATCGTCGGCCATGCCCATGCTGGGCG
GCGAGCCGGCCCTGGAGCCCATCGCCATCGAAGGCGACGAAGGGCTCAGCAGGCTGTTCCATTACACCCT
GACCCTGGCCACCCCCGAGCAGCCCGGCTACAACGAACGCCAGGCCGCCAACGTGGCCATCAAGCAGCTG
GTGGGCGAGGCGCTCACGGCGCACATCGTGCTCGATGGACGCCCGGGCTCGGGCCCGCAGCGGCGCCATC
TCTCGGGCCTTGTGACGCGCGTGCGCTTCTTGCGTCTGGAGAACCGGCGTGCGCTGTACGAAGCCGTGAT
CGAGCCCTGGCTCACGCTGGGCACGCGCACCAGCGACTACCGCATCTTCCAGAACCAGAACGTGCTGGAC
ATCGTCAGGGAGGTGCTCGGCAAGTACGGGCTTCCCTTCGACGTGCGGGCCGTGCGCAGCTATCCGCCGC
GCGAGTTCCAGGTGCAGTACGGCGAAAGCGACTACGACTTCGTCGCACGGCTGCTGCACGAGTGGGGCCT
GTACTTCTACTTCGAGCACGAAGAGAGCAGTCACAAGCTGGTGATCGTCGACGACATGGCGTCGCACCAG
CCCTTCGCCCATGCGGGCTACCAGCGCATTCCCTTCCATGCGGCGGAGGCCACCGTGCGCGAGGAGCATT
GCGACCGCTTCAACGCCTGCGAGGCGCTGCAAAGCGGCCGCTGGGTGATCGGCGACTTCGACTTCAAGCG
CCCGAAGGCCGAGCTGCAGCAGGTCAGCGCCATGCCGCGCAAGACGGCGCAGAACACCTGGGAGCGCTAT
GGCTGGCCGGGCGACTACGTGGTGGAGTCCGAAGGCGAGCAGCTGGTGCGCACGCGCATGGAAGAGACCG
GCAGCCAGGGCGAGCGCGCCGGCGGCTCGGGCAACCTGCGCGCGGTGGTGCCGGGCTGCCTGGTCACGCT
GGAGCGCCATCCCCAGAACGAGTCGAACCGCGAGTACCTGGTGACGGACGCCCGCTTGCGGCTGCAGGAC
GTGGGCGATGCCAGTGCGCAGCAGGAATTCGAGTGCCGCGTCGATTTCGAGGTGATTCCGACGAGCAAGG
TGTTCAGGGCATCGGCCCCGCCGGTGCCCAGGCCGCGCACCACGGGCCCGCAGACGGCGATCGTCACGGG
CCCGGCCGGCCGCGAGATCTGGACCGATGAATACGGCCGCGTGAAGCTCAGCTTCCACTGGAACCGCTAC
TGCACGAAGGACGAGAACAGCTCGTGCTGGGTGCGCGTGTCCTCGCCCTGGGCCGGCACCAATTTCGGCG
GCATCCAGATCCCGCGCATCGGCCAGGAGGTGATCGTCGACTTCGAGAACGGCGACCCCGACCGCCCCAT
CGTCACGGGGCGCGTCTACAACGCCGACAACATGCCGCCGTGGACCCTGCCGGACAACGCCACGCAAAGC
GGCCTGCTCACGCGCAGCTCCGAAGGCGCGACCGATGCCAATGCCAATGCGCTGCGCTTCGAGGACAAGA
AGGGCCAGGAGCAGCTGTGGCTGCATGCGGAGCGCAACCAGGACATCGAGGTCGAGCGCGACGAGACGCA
CTGGGTGGGCAACGACCGCACCAAGACCATCGACCGCGACGAAACCGTGCATGTGAAGCACGACCGCACG
GAGACCGTCGATCACGACGAGACCATCACCGTCCACAACAACCGCACCGAGACGGTCGATGGCAACGAGA
CGATCACGATCCACAAGAACCGCACCGAGACCGTGGACCTCGACGAGACCATCACGGTGCACAAGAACCG
CACCGAGACCGTCGACCTCAACGAGACCATCGGCATCGGCATGAACCGCACCGAGACGGTGGGCATGAAC
GAGACCATCGACATCGGCGACAACCGCGTGGTGACCATCGGCGGCAACAAGGCCGAGACGGTGGCCCTGG
CCAAGGCCGAGACCATCGGCCTTGCCAAGGCGCTGACCATCGGCCTGGGCTACCAGGTGTCGGTGGGCGC
GGCAATGAACACCAGCGTGGCGCTGATGCAGACCGAGCAGGTCGGGCGCTCCAAGCGCGTCGATGTGCGC
AACACCTTCGATATAACCGCGGGCGACGAATTCAGCATCACGGTCGGTAAGTCCACGCTGGTGATGAAGT
CCGATGGCACCATCACCTTCAACGGCCACACCTTCAACGTCGGCACGAGCGGCGAGCAGTATTTCAACGC
CGATGGACACATCACGTCGAAGGCGAACAAGATCCAGGAGAACTGA