SecReT6
Protein ID: 538392473
SecReT6 ID845
T6SS typei3
Gene symbol-
Locus tagVAPA_1c02430
StrainVariovorax paradoxus B4
Repliconchromosome I [GenBank: NC_022247] [Browse all T6SS(s) in this replicon]
Location [Strand]255234..257159 [-]
Productputative type VI secretion system protein, FHA domain-containing
NoteFha
UniProt IDT1X435
KEGG IDvpd:VAPA_1c02430
PDB IDNA
Domain hit(s) vs Pfam FHA [PF00498], Evalue: 7.10E-08, Aligned region: 27..95
Protein Sequence: 641 a.a.     [Download]
>gi|538392473|ref|YP_008514046.1| putative type VI secretion system protein, FHA domain-containing [Variovorax paradoxus B4]
MRWTVIEHAGKPVTAGPSALLAAPGGTIGRSPDNHLVLPDEQRQISRLQATVRFDDSGATVLRNMSAVLP
IGVNERTLQHEQESPIADGDRVTIGSYVLVAGNGRRAVAVEPAAPLMAAAPPPAAPVRNATPAGATAQAP
MGSLLPAAPVSDVFSDLFGAGALPIGDTQPVTVAMPPPAVPAAPPPAEAFAAAPVPAASRSPSPSPAPSP
ASTQPGAPQIPSAADWDAILANAPRREANASEPMPDPMAHEPFELPSQARRNPVDPLAELNPRAEDGMSD
VALKRGMDPLSFFAADNDAPSPLSDPRPTALTHEDPLSDVHPAVDLLARPAAPQGYSHSNHARELTAQFR
PPNPVAFDAPAVKANETQVSSAPEPPAPVPAPAPAPAPAPAASMPVTAGRADIAPPAKPAPPEPPAPEPK
PAAAAPSPVAAPAAPVAAPSSSDELFKAFLEGAGVPDVAGQQPLDAEAMRRLGRLMRAFTDGTIELLSSR
AMLKREVRAEITMIVDEENNPFKILPNGRAVLMQMFGARMPGFLSPEAAVHDALGDLQSHQLGMVAGMRA
ALLTVLKRFDPTALNTATPHDGGLGEKLLPGGREARLWRQLQKLHAETTAAVEDDFQAVFGRAFQQAYDK
EMERLKEARRA
 
Nucleotide Sequence: 1926 bp     [Download]
>gi|538392231|ref|NC_022247.1|:c257159-255234 Variovorax paradoxus B4 chromosome 1, complete sequence
ATGCGTTGGACGGTGATCGAACATGCCGGCAAGCCGGTGACCGCGGGGCCCTCGGCCTTGCTCGCGGCAC
CCGGTGGAACCATCGGGCGCAGCCCCGACAACCACCTGGTGCTGCCCGACGAACAGCGCCAGATCTCGCG
CCTGCAGGCCACCGTGCGTTTCGACGACAGTGGCGCGACGGTGCTGCGCAACATGAGCGCGGTGCTGCCC
ATCGGCGTCAACGAGCGCACGCTGCAGCACGAGCAGGAGTCGCCGATCGCCGATGGCGACCGCGTGACCA
TCGGGAGCTATGTGCTGGTGGCGGGGAACGGGCGGCGCGCCGTGGCCGTCGAGCCCGCCGCCCCACTGAT
GGCGGCAGCACCGCCACCGGCCGCGCCTGTGCGCAACGCAACGCCCGCCGGCGCCACGGCGCAAGCGCCG
ATGGGCTCGCTGCTGCCGGCGGCACCCGTCTCCGACGTGTTCTCGGACCTCTTCGGCGCAGGCGCATTGC
CGATCGGCGATACGCAGCCCGTGACCGTGGCGATGCCACCGCCGGCCGTGCCGGCAGCGCCGCCGCCTGC
CGAAGCTTTCGCCGCCGCGCCGGTGCCTGCGGCGTCGCGATCGCCATCGCCATCGCCAGCCCCATCGCCG
GCAAGCACTCAGCCGGGCGCCCCGCAGATTCCTTCCGCCGCCGATTGGGATGCCATCCTCGCGAATGCGC
CGCGCCGCGAGGCGAACGCCTCCGAGCCCATGCCCGACCCGATGGCGCACGAGCCTTTCGAGCTGCCGTC
GCAGGCGCGCAGGAATCCGGTCGATCCGCTGGCCGAGCTGAATCCGCGTGCGGAAGACGGCATGTCCGAC
GTGGCGCTGAAGCGCGGCATGGACCCGCTGTCTTTCTTTGCCGCCGACAACGATGCGCCCTCGCCGCTTT
CCGATCCGCGCCCCACCGCGCTGACCCACGAAGATCCGCTCAGCGACGTGCATCCGGCAGTCGATCTGCT
GGCCAGGCCGGCCGCCCCGCAGGGATACAGCCATTCGAACCATGCGCGGGAATTGACGGCGCAATTCAGG
CCGCCGAACCCGGTGGCCTTCGATGCGCCGGCTGTGAAGGCCAACGAGACGCAGGTGTCCTCGGCGCCTG
AGCCGCCAGCACCAGTCCCGGCACCGGCACCGGCACCGGCACCGGCACCGGCAGCATCGATGCCGGTCAC
CGCCGGCCGCGCGGACATTGCACCGCCTGCAAAGCCCGCGCCGCCTGAACCGCCCGCACCAGAACCGAAG
CCCGCTGCTGCTGCGCCGTCGCCGGTGGCCGCGCCGGCAGCCCCTGTCGCAGCGCCCTCCTCTTCGGACG
AACTCTTCAAGGCCTTCCTCGAAGGCGCAGGCGTGCCCGACGTTGCCGGCCAGCAACCGCTGGACGCCGA
AGCCATGCGGCGCCTCGGCCGGCTCATGCGCGCATTCACCGACGGCACCATCGAGCTGCTCTCGTCGCGC
GCCATGCTCAAGCGCGAAGTGCGTGCCGAGATCACGATGATCGTCGACGAAGAGAACAACCCCTTCAAGA
TCCTTCCCAACGGCCGCGCCGTGCTGATGCAGATGTTCGGCGCGCGCATGCCCGGCTTCCTGTCGCCCGA
GGCGGCCGTGCACGACGCACTCGGCGACCTGCAGTCGCATCAGCTCGGCATGGTGGCCGGCATGCGCGCC
GCGCTGCTCACTGTGCTCAAGCGCTTCGACCCCACGGCATTGAACACCGCCACGCCGCACGACGGCGGGC
TGGGCGAGAAGCTGTTGCCCGGCGGCCGCGAGGCGCGCCTGTGGCGCCAGCTGCAGAAGCTGCATGCCGA
GACCACCGCGGCCGTCGAGGACGACTTCCAGGCCGTCTTCGGCCGGGCCTTCCAGCAGGCCTACGACAAG
GAGATGGAACGGTTGAAGGAGGCGCGCCGTGCTTGA