SecReT6
Protein ID: 538392475
SecReT6 ID845
T6SS typei3
Gene symbol-
Locus tagVAPA_1c02450
StrainVariovorax paradoxus B4
Repliconchromosome I [GenBank: NC_022247] [Browse all T6SS(s) in this replicon]
Location [Strand]257738..258253 [+]
Producttype VI secretion lipoprotein, VC_A0113 family
NoteTssJ
UniProt IDT1X5C3
KEGG IDvpd:VAPA_1c02450
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 1.20E-33, Aligned region: 19..165
Protein Sequence: 171 a.a.     [Download]
>gi|538392475|ref|YP_008514048.1| type VI secretion lipoprotein, VC_A0113 family [Variovorax paradoxus B4]
MHRRTLLQGALATAPLLGGLSGCASTAKSLPTPYAVTIKIDDGVNPDGRGQPAPILVKVFELKSSGNFET
ADYFALQDRDRETLSTELVNADQAIMRSGEDRVFKREAGLDSRAIGIIAGYRKLEAARWRIVLPLKEPKQ
TNLYKVWQFSPSEQTVRIAIRKSGIELLPSR
 
Nucleotide Sequence: 516 bp     [Download]
>gi|538392231|ref|NC_022247.1|:257738-258253 Variovorax paradoxus B4 chromosome 1, complete sequence
ATGCATCGACGAACCCTGCTTCAAGGCGCACTTGCAACCGCACCGTTGCTCGGTGGCCTCAGTGGATGCG
CATCGACTGCGAAGTCATTGCCCACGCCATACGCCGTGACCATCAAGATCGACGATGGCGTCAACCCCGA
CGGACGCGGCCAGCCAGCGCCGATTCTCGTCAAGGTCTTCGAATTGAAATCTTCCGGTAACTTCGAGACA
GCAGACTACTTTGCACTACAGGACCGCGATCGCGAAACGCTTTCGACGGAACTCGTGAATGCCGACCAGG
CCATCATGCGCAGCGGCGAAGATCGTGTCTTCAAGCGCGAGGCAGGGCTCGATTCGCGTGCCATCGGCAT
CATCGCCGGCTACCGCAAGCTCGAGGCCGCGCGATGGCGCATCGTGTTGCCGCTCAAGGAGCCGAAGCAA
ACCAATCTGTACAAGGTGTGGCAGTTTTCTCCGAGCGAGCAAACCGTGCGCATCGCGATCCGCAAGAGCG
GCATCGAGTTACTACCAAGTCGTTAA