SecReT6
Protein ID: 538392476
SecReT6 ID845
T6SS typei3
Gene symbol-
Locus tagVAPA_1c02460
StrainVariovorax paradoxus B4
Repliconchromosome I [GenBank: NC_022247] [Browse all T6SS(s) in this replicon]
Location [Strand]258416..259792 [+]
Producttype VI secretion protein, VC_A0114 family
NoteTssK
UniProt IDT1X4K4
KEGG IDvpd:VAPA_1c02460
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 9.80E-146, Aligned region: 34..457
Protein Sequence: 458 a.a.     [Download]
>gi|538392476|ref|YP_008514049.1| type VI secretion protein, VC_A0114 family [Variovorax paradoxus B4]
MTVRNPGAGKHGALPQALANRVVWSEGMYLRPQHFQQLERYVEQYVTRRTAGLQGAYWGWLSLDIDRDAH
ALGRVSLLGGAGVLPDGTPFSFGAEDAPLPYEVPSDLTDELIVLALPLRRTGSEEILFADDEGSAARFGV
IEREVADGNSVALGPAVLQLAKPRLRLARASSLTAEWQAIGAVRVIERRTDHKLVIDANYIPPVLDASAH
PMLRSMVSELHGLLTQRSEALASRLSQPGRGGVSEVSDFLLLELVNRYLALTWHAQHAVQVHPEELFVDW
FKLACHLATHTSPTRRPVVWPKYDHDNLNETIRPLMEELRRSLSAVLEQSAIAIELEERSHGVRVGRMPD
PVLVRNAGFVLAVHANLPADAIQQRFPTQVKIGSVERIRDLVQLQLPGVTVRPLPVAPRQIPYNAGYHYF
ELDKSGDMWRQLEKSGGVAMHLAGDFPGLAMEFWAIRP
 
Nucleotide Sequence: 1377 bp     [Download]
>gi|538392231|ref|NC_022247.1|:258416-259792 Variovorax paradoxus B4 chromosome 1, complete sequence
GTGACAGTTCGCAATCCGGGCGCCGGCAAGCATGGCGCCCTTCCGCAGGCATTGGCGAATCGCGTGGTGT
GGTCCGAAGGCATGTACCTGAGGCCCCAGCATTTCCAGCAACTGGAGCGCTATGTCGAGCAGTACGTCAC
GCGCCGTACCGCGGGCCTGCAAGGTGCCTATTGGGGATGGCTCAGCCTGGACATCGATCGCGATGCCCAT
GCACTCGGACGCGTGTCGCTGCTCGGCGGCGCCGGCGTGCTGCCCGACGGCACGCCGTTCTCGTTCGGCG
CCGAAGATGCGCCGCTGCCTTACGAGGTGCCGAGCGACCTGACCGATGAACTCATCGTGCTTGCGCTGCC
GCTGCGCCGCACCGGCAGCGAAGAGATCCTCTTCGCCGACGACGAGGGATCGGCCGCGCGCTTCGGCGTG
ATCGAGCGCGAGGTGGCCGACGGCAATTCGGTGGCGCTCGGCCCGGCGGTGCTGCAGCTTGCGAAGCCGC
GCCTGCGCCTTGCGCGCGCGTCGTCGCTCACGGCGGAGTGGCAGGCCATCGGTGCGGTACGCGTCATAGA
GCGGCGCACCGACCACAAGCTGGTGATCGACGCCAACTACATTCCGCCGGTGCTCGATGCATCGGCGCAC
CCCATGCTGCGCAGCATGGTTTCCGAGCTGCACGGCCTGCTCACGCAGCGCTCCGAGGCCCTGGCCTCGC
GGCTCTCGCAGCCCGGCCGCGGCGGCGTGAGCGAGGTCTCCGACTTTCTCCTGCTCGAACTCGTCAACCG
CTATCTCGCACTGACCTGGCATGCGCAGCATGCGGTGCAGGTGCACCCCGAGGAACTGTTCGTCGACTGG
TTCAAGCTGGCCTGCCATCTGGCCACGCACACCTCGCCCACGCGGCGCCCCGTGGTGTGGCCGAAGTACG
ACCACGACAATCTCAACGAGACGATCCGGCCGCTGATGGAAGAGCTGCGGCGCTCGCTCTCGGCCGTGCT
CGAGCAGAGCGCCATCGCCATCGAGCTGGAGGAGCGCAGCCACGGCGTGCGCGTGGGCCGCATGCCCGAT
CCGGTGCTGGTGCGCAACGCGGGCTTCGTGCTTGCGGTGCATGCCAACCTGCCCGCCGATGCCATCCAGC
AGCGCTTTCCGACGCAGGTCAAGATCGGTTCGGTGGAGCGCATCCGCGACCTCGTGCAGCTGCAGCTGCC
GGGCGTCACGGTGCGGCCGCTGCCGGTGGCGCCGCGCCAGATTCCATACAACGCGGGCTACCACTATTTC
GAACTCGACAAGAGTGGCGACATGTGGCGCCAGCTCGAAAAATCGGGCGGCGTTGCAATGCACCTGGCCG
GCGACTTCCCGGGCCTGGCCATGGAGTTCTGGGCAATTCGTCCGTGA