SecReT6
Protein ID: 538392477
SecReT6 ID845
T6SS typei3
Gene symbol-
Locus tagVAPA_1c02470
StrainVariovorax paradoxus B4
Repliconchromosome I [GenBank: NC_022247] [Browse all T6SS(s) in this replicon]
Location [Strand]259801..261177 [+]
Producttype IV/VI secretion system protein, DotU family
NoteTssL
UniProt IDT1X386
KEGG IDvpd:VAPA_1c02470
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 1.80E-73, Aligned region: 69..273
DUF2077 [PF09850], Evalue: 1.80E-73, Aligned region: 408..444
OmpA [PF00691], Evalue: 4.00E-16, Aligned region: 337..435
RskA [PF10099], Evalue: 8.60E-05, Aligned region: 212..346
RskA [PF10099], Evalue: 8.60E-05, Aligned region: 409..451
Protein Sequence: 458 a.a.     [Download]
>gi|538392477|ref|YP_008514050.1| type IV/VI secretion system protein, DotU family [Variovorax paradoxus B4]
MNGVNDMAVGPGGFVPPNPGGGGNNSGNGDPAGVPLASRGAGQQQPQSFTAWHDARRPHAGDTALAGNNP
LVAAANPLLDLIPQIRATGHHDAPAQLREHLVDEVRRFETRAQQSGIAPEVIIGARYCLCTAVDEAAALT
PWGGSIWSSQSLLVMFHNETWGGEKFFQLLSRLVQNPQQHLQLIELIYFCLAMGFEGRFRVIDNGRTQLE
TLKQRLLQIIRQARGEIAAPLSPHWQDASAPVRRTRNWVPLWAVGAVAAVLLVLVFGVLTFSLASRSDGA
FAAVNAVRLPQTQRAVAVAPAPQPRLQRFLEPEIRDGLLTVRDEADRSVVVLRGDGLFASGSDRVLDRYA
PVLARVADALNSVEGNVLISGFSDNQPIRSVRFPSNWQLSQARADAVKKMIATRVTRPERLRAEGRGDAD
PLVPNDSPANRARNRRVEVTLLVAPVAGAAAPLQGGTR
 
Nucleotide Sequence: 1377 bp     [Download]
>gi|538392231|ref|NC_022247.1|:259801-261177 Variovorax paradoxus B4 chromosome 1, complete sequence
ATGAACGGTGTCAACGACATGGCCGTCGGTCCGGGAGGCTTCGTGCCGCCCAACCCGGGCGGCGGCGGCA
ACAACAGCGGCAACGGCGATCCCGCGGGCGTGCCCCTGGCATCGCGCGGCGCCGGGCAGCAGCAACCCCA
GTCATTCACCGCATGGCATGACGCACGCCGTCCGCATGCGGGCGACACGGCGCTGGCCGGCAACAATCCG
CTTGTCGCGGCGGCCAACCCGCTGCTCGACCTGATCCCGCAGATCCGCGCCACCGGCCACCACGATGCGC
CCGCGCAGTTGCGCGAGCACCTGGTCGACGAGGTCAGGCGCTTCGAAACGCGCGCGCAACAAAGCGGCAT
TGCGCCCGAGGTGATCATCGGCGCGCGCTACTGCCTGTGCACCGCGGTCGACGAGGCGGCCGCGCTCACG
CCGTGGGGCGGCAGCATCTGGTCGTCGCAGAGCCTGCTCGTGATGTTCCACAACGAGACCTGGGGCGGCG
AGAAATTCTTCCAGCTGCTGTCGCGGCTGGTGCAGAACCCGCAGCAGCATCTGCAGCTGATCGAGCTCAT
CTACTTCTGCCTGGCCATGGGCTTCGAAGGGCGCTTCCGCGTCATCGACAACGGCCGCACGCAGCTGGAG
ACGCTCAAGCAGCGGCTGCTGCAGATCATTCGCCAGGCGCGCGGCGAAATTGCCGCGCCGCTGTCGCCGC
ACTGGCAGGATGCGAGCGCGCCGGTGCGCCGCACGCGCAACTGGGTGCCGCTGTGGGCCGTGGGCGCGGT
GGCGGCGGTGCTGCTGGTGCTCGTGTTCGGCGTGCTCACCTTCAGCCTGGCCAGCCGTTCCGACGGCGCA
TTCGCCGCGGTCAATGCGGTGCGCCTGCCGCAGACGCAGCGCGCCGTGGCCGTTGCGCCGGCACCGCAGC
CGCGGCTGCAGCGATTCCTCGAACCCGAGATCCGCGACGGCCTGCTGACCGTGCGCGACGAGGCCGACCG
CAGCGTGGTGGTGCTGCGCGGCGACGGCCTGTTCGCATCGGGCTCCGACCGCGTGCTCGACCGCTATGCG
CCCGTGCTCGCGCGCGTGGCCGACGCGCTCAATTCGGTGGAAGGCAACGTGCTCATCAGCGGCTTCAGCG
ACAACCAGCCGATTCGCAGCGTGCGCTTCCCGTCCAACTGGCAGCTCTCGCAGGCGCGTGCCGATGCGGT
CAAGAAGATGATCGCCACGCGCGTCACCCGCCCCGAGCGCCTGCGCGCCGAAGGCCGCGGCGATGCCGAT
CCCCTGGTGCCCAATGATTCGCCGGCCAACCGTGCGCGCAACCGGCGGGTCGAAGTGACGCTGCTGGTGG
CGCCCGTGGCCGGCGCCGCAGCGCCGTTGCAGGGAGGAACCCGCTGA