SecReT6
Protein ID: 538392494
SecReT6 ID845
T6SS typei3
Gene symbol-
Locus tagVAPA_1c02640
StrainVariovorax paradoxus B4
Repliconchromosome I [GenBank: NC_022247] [Browse all T6SS(s) in this replicon]
Location [Strand]281217..281744 [-]
Producthypothetical protein
NoteTssI
UniProt IDT1X4X3
KEGG IDvpd:VAPA_1c02640
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 175 a.a.     [Download]
>gi|538392494|ref|YP_008514067.1| hypothetical protein VAPA_1c02640 [Variovorax paradoxus B4]
MHANDRRANPPALPSLQGDALLEELIAKPADKPERRGAQGIVLGTLVDLGVEGAEKAVPRVRLAGMGTMD
VLCSLVPLAATDVGSTVALGFSGVDMRQAIILGLVWEPQEQRPPAPAVPRGDGRVVIEATNEIELRCGES
ALILSADGRIQLRGHYITSHASATQRILGGSVNVN
 
Nucleotide Sequence: 528 bp     [Download]
>gi|538392231|ref|NC_022247.1|:c281744-281217 Variovorax paradoxus B4 chromosome 1, complete sequence
GTGCACGCCAACGACCGTCGCGCCAATCCGCCCGCGTTGCCATCGCTTCAGGGCGATGCGCTGCTCGAGG
AGCTGATTGCAAAGCCCGCCGACAAGCCAGAGCGCCGTGGCGCGCAGGGCATCGTGCTCGGCACGTTGGT
CGATCTGGGTGTCGAAGGTGCGGAGAAGGCCGTGCCGCGCGTGCGCCTGGCCGGCATGGGCACGATGGAC
GTGCTGTGTTCGCTGGTGCCGCTGGCCGCGACCGATGTAGGAAGCACGGTGGCACTGGGTTTCAGTGGCG
TCGACATGCGCCAGGCCATCATCCTGGGCCTTGTGTGGGAGCCGCAGGAGCAAAGACCACCAGCACCAGC
CGTGCCGCGCGGCGACGGGCGCGTTGTCATCGAAGCAACAAATGAGATCGAACTGCGCTGCGGCGAGTCG
GCACTCATCCTCTCGGCTGACGGTCGCATCCAGCTGCGCGGTCACTACATCACCAGCCATGCCAGCGCGA
CTCAGCGCATTCTGGGCGGCTCGGTCAACGTCAATTGA