SecReT6
Protein ID: 541870624
SecReT6 ID847
T6SS typei1
Gene symbol-
Locus tagM892_22360
StrainVibrio campbellii ATCC BAA-1116
Repliconchromosome II [GenBank: NC_022270] [Browse all T6SS(s) in this replicon]
Location [Strand]1007964..1010648 [-]
ProductT6SS/ATPase, ClpA/B (ClpV1 family) VasG
NoteTssH
UniProt IDA7N4P3
KEGG IDvha:VIBHAR_05872
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 7.00E-45, Aligned region: 221..271
AAA_2 [PF07724], Evalue: 7.00E-45, Aligned region: 628..792
AAA [PF00004], Evalue: 1.60E-22, Aligned region: 222..350
AAA [PF00004], Evalue: 1.60E-22, Aligned region: 633..757
ClpB_D2-small [PF10431], Evalue: 1.00E-14, Aligned region: 799..873
AAA_16 [PF13191], Evalue: 1.90E-14, Aligned region: 197..237
AAA_16 [PF13191], Evalue: 1.90E-14, Aligned region: 264..298
AAA_16 [PF13191], Evalue: 1.90E-14, Aligned region: 406..505
AAA_16 [PF13191], Evalue: 1.90E-14, Aligned region: 604..655
AAA_16 [PF13191], Evalue: 1.90E-14, Aligned region: 697..726
AAA_16 [PF13191], Evalue: 1.90E-14, Aligned region: 854..873
AAA_5 [PF07728], Evalue: 1.50E-13, Aligned region: 222..240
AAA_5 [PF07728], Evalue: 1.50E-13, Aligned region: 294..350
AAA_5 [PF07728], Evalue: 1.50E-13, Aligned region: 632..790
AAA_22 [PF13401], Evalue: 9.40E-10, Aligned region: 220..316
AAA_22 [PF13401], Evalue: 9.40E-10, Aligned region: 630..745
Sigma54_activat [PF00158], Evalue: 1.50E-06, Aligned region: 220..278
Sigma54_activat [PF00158], Evalue: 1.50E-06, Aligned region: 435..472
Sigma54_activat [PF00158], Evalue: 1.50E-06, Aligned region: 632..753
AAA_17 [PF13207], Evalue: 4.40E-06, Aligned region: 222..285
AAA_17 [PF13207], Evalue: 4.40E-06, Aligned region: 462..462
AAA_17 [PF13207], Evalue: 4.40E-06, Aligned region: 631..655
AAA_25 [PF13481], Evalue: 1.60E-05, Aligned region: 220..247
AAA_25 [PF13481], Evalue: 1.60E-05, Aligned region: 275..315
AAA_25 [PF13481], Evalue: 1.60E-05, Aligned region: 628..664
IstB_IS21 [PF01695], Evalue: 4.80E-05, Aligned region: 214..242
IstB_IS21 [PF01695], Evalue: 4.80E-05, Aligned region: 632..652
IstB_IS21 [PF01695], Evalue: 4.80E-05, Aligned region: 742..762
Zeta_toxin [PF06414], Evalue: 8.70E-05, Aligned region: 142..171
Zeta_toxin [PF06414], Evalue: 8.70E-05, Aligned region: 220..238
Zeta_toxin [PF06414], Evalue: 8.70E-05, Aligned region: 300..342
Zeta_toxin [PF06414], Evalue: 8.70E-05, Aligned region: 631..672
NACHT [PF05729], Evalue: 9.80E-05, Aligned region: 222..247
NACHT [PF05729], Evalue: 9.80E-05, Aligned region: 279..320
NACHT [PF05729], Evalue: 9.80E-05, Aligned region: 632..657
AAA_19 [PF13245], Evalue: 0.00014, Aligned region: 217..241
AAA_19 [PF13245], Evalue: 0.00014, Aligned region: 629..654
AAA_18 [PF13238], Evalue: 0.00045, Aligned region: 223..242
AAA_18 [PF13238], Evalue: 0.00045, Aligned region: 497..547
AAA_18 [PF13238], Evalue: 0.00045, Aligned region: 633..661
Arch_ATPase [PF01637], Evalue: 0.00064, Aligned region: 200..233
Arch_ATPase [PF01637], Evalue: 0.00064, Aligned region: 272..305
Arch_ATPase [PF01637], Evalue: 0.00064, Aligned region: 631..653
RuvB_N [PF05496], Evalue: 0.00074, Aligned region: 220..237
RuvB_N [PF05496], Evalue: 0.00074, Aligned region: 275..300
RuvB_N [PF05496], Evalue: 0.00074, Aligned region: 584..654
AAA_23 [PF13476], Evalue: 0.003, Aligned region: 222..237
AAA_23 [PF13476], Evalue: 0.003, Aligned region: 433..494
AAA_23 [PF13476], Evalue: 0.003, Aligned region: 630..744
RNA_helicase [PF00910], Evalue: 0.003, Aligned region: 222..241
RNA_helicase [PF00910], Evalue: 0.003, Aligned region: 633..654
RNA_helicase [PF00910], Evalue: 0.003, Aligned region: 734..751
DUF258 [PF03193], Evalue: 0.0038, Aligned region: 190..238
DUF258 [PF03193], Evalue: 0.0038, Aligned region: 631..653
ResIII [PF04851], Evalue: 0.0084, Aligned region: 203..239
ResIII [PF04851], Evalue: 0.0084, Aligned region: 290..303
ResIII [PF04851], Evalue: 0.0084, Aligned region: 451..487
ResIII [PF04851], Evalue: 0.0084, Aligned region: 602..653
Protein Sequence: 894 a.a.     [Download]
>gi|541870624|ref|YP_008529028.1| T6SS/ATPase, ClpA/B (ClpV1 family) VasG [Vibrio campbellii ATCC BAA-1116]
MAMININLSSLIQRLHPIAKVALEDAAALAVSEKANEVQIEHYLLSLLERPNSDFDVLLSHFDCSENLLR
QSVRSTLDTNAKGNGSKPVFSALLIEWLQESWLVSSLDLSETQIRSGALLLTLVSNPLRYGQNGYASILE
AVNPDSLKRNFAELTSHSIEAQVATSEKTQAREDGSALSKFTTDFTGKARKGEIDPVFCRDQEIRQIVDI
LARRRKNNPIAVGEPGVGKTAVVEGLALKIVQGDVPDNLKGVELYGLDMGLLQAGASVKGEFEKRLNAVL
DEVKNSPTPIILFIDEAHTLVGGGNQAGGSDAANLLKPALARGEVKTIAATTWSEYKKYFEKDPALARRF
QLVKLDEPSPEQAALIIRGLRPAYEKSHNVYVRDDAITAAAALSARYISGRQLPDKAIDVLDTACARVNI
SLNAIPASVETLQQELAAQQRELEALERDALQQTGDKHSLANIPDLKLAMETTKEELAEQEEQWHKEKEQ
IQEMIALRSRLHELVFGEANEEELAADEDSEQDQDVSPYAEMDEEAVRIAISACQEQLDAIRNGNPLVHF
EVGPDEVSHVISDWTGIPMGKMLQDEAETTLKLKESLTQSIKGQEYAIDALSEGIQTAKAGLGNPDAPTG
VFLLVGPSGVGKTETARAIADQMFGGERFMTTINMSEFQEKHTVSRLIGSPPGYVGYGEGGMLTEAVRQR
PYSVVLLDEVEKADPEVLNLFYQVFDKGTLNDGEGRTIDFKNTLIIMTSNLATHEIESLVHQSKDIDANI
IAEAIRPTLNQHFKPALLARMSVLPFVPLSDEAMTEIIHHKLNKVSQRLQSHHKLSLSYEESLVEFVLGN
CRLAETGARNIDAVINRQLLPQLSTQLLVHDKDDSHTQIAVSVDEQGTLTYAFS
 
Nucleotide Sequence: 2685 bp     [Download]
>gi|541870142|ref|NC_022270.1|:c1010648-1007964 Vibrio campbellii ATCC BAA-1116 chromosome II, complete sequence
ATGGCTATGATAAATATAAACCTTTCTTCATTAATTCAGCGTCTACACCCGATTGCAAAAGTGGCATTAG
AAGACGCGGCTGCACTTGCAGTCTCTGAAAAAGCAAACGAAGTTCAAATTGAGCATTATTTACTGAGTCT
TTTAGAAAGGCCAAATAGTGATTTTGACGTCTTATTAAGTCATTTTGATTGTTCTGAGAACTTATTAAGA
CAATCGGTTCGATCCACACTCGATACCAACGCCAAAGGAAATGGCAGCAAACCTGTTTTTTCTGCTTTAT
TAATCGAATGGTTACAAGAAAGCTGGCTGGTTTCTTCTTTAGATCTATCCGAAACACAAATCCGCTCTGG
CGCCCTACTCCTTACTCTTGTTAGCAACCCTCTACGTTACGGCCAAAATGGTTACGCCTCTATCCTTGAA
GCGGTAAACCCTGACAGCCTTAAGCGTAACTTTGCAGAGCTAACAAGCCACTCTATTGAGGCGCAAGTCG
CGACTTCCGAAAAAACACAAGCTCGCGAAGATGGCTCGGCATTGAGCAAGTTCACGACAGACTTCACTGG
TAAAGCACGCAAAGGCGAAATCGATCCTGTTTTCTGCCGCGACCAAGAAATCCGCCAAATCGTGGACATT
CTTGCTCGTCGCCGTAAAAACAACCCTATCGCTGTCGGTGAGCCGGGCGTTGGTAAAACCGCAGTCGTAG
AAGGCTTGGCGCTAAAAATCGTACAAGGCGACGTACCAGACAACCTTAAAGGTGTTGAGCTTTATGGTCT
GGACATGGGTCTTCTACAAGCAGGTGCAAGCGTAAAAGGTGAATTCGAAAAACGCCTAAACGCAGTATTG
GATGAAGTGAAAAACTCGCCAACGCCAATCATCCTATTCATCGATGAAGCACACACTCTAGTCGGCGGCG
GTAACCAAGCGGGCGGCAGTGATGCAGCCAACTTGTTAAAACCTGCCCTAGCACGTGGCGAAGTGAAAAC
AATTGCTGCAACAACCTGGTCGGAATACAAAAAGTACTTCGAGAAAGATCCAGCGCTTGCACGTCGCTTC
CAGCTGGTAAAACTTGATGAGCCTTCTCCAGAGCAAGCGGCATTGATCATTCGTGGTCTGCGCCCAGCTT
ACGAGAAGTCACACAATGTATACGTACGCGATGACGCGATCACCGCAGCTGCAGCGCTTTCTGCTCGTTA
CATCTCTGGCCGTCAACTACCAGACAAAGCGATCGATGTACTAGATACGGCATGTGCGCGAGTGAACATC
AGCCTTAATGCTATCCCTGCTTCTGTAGAAACACTTCAGCAAGAACTTGCTGCCCAACAGCGCGAGCTTG
AAGCACTTGAGCGTGATGCTCTGCAGCAAACTGGTGACAAGCACAGCCTTGCTAACATTCCGGACCTAAA
ACTGGCAATGGAAACAACCAAAGAAGAGTTAGCAGAGCAAGAAGAGCAATGGCACAAAGAAAAAGAGCAG
ATCCAAGAGATGATTGCTCTACGTTCTCGCCTGCATGAACTGGTCTTTGGCGAAGCAAATGAAGAAGAGC
TTGCTGCAGACGAAGATTCAGAACAAGATCAAGACGTTTCTCCATACGCAGAAATGGATGAAGAAGCGGT
TCGCATTGCAATTTCAGCCTGCCAAGAACAGCTAGACGCAATCCGCAATGGCAACCCACTGGTTCATTTT
GAAGTTGGCCCAGATGAAGTCAGCCACGTGATCTCGGACTGGACCGGTATTCCAATGGGTAAGATGCTTC
AAGACGAAGCAGAGACCACGCTAAAACTGAAAGAAAGCCTAACACAAAGCATCAAAGGCCAAGAATACGC
TATCGATGCACTGTCTGAAGGCATTCAAACGGCGAAAGCTGGCCTAGGTAACCCAGACGCACCAACAGGC
GTATTCCTGCTGGTTGGCCCAAGTGGCGTGGGTAAAACTGAAACGGCTCGTGCGATCGCTGATCAAATGT
TTGGTGGCGAGCGCTTTATGACGACCATCAACATGTCTGAGTTCCAAGAGAAGCACACGGTATCTCGCCT
AATTGGTTCACCTCCGGGTTACGTAGGTTACGGTGAAGGCGGCATGCTGACAGAAGCGGTACGTCAACGC
CCATATTCAGTTGTACTGCTAGATGAAGTTGAAAAAGCCGACCCAGAAGTGTTGAACCTGTTCTACCAAG
TGTTCGACAAAGGTACGTTAAACGACGGCGAAGGCCGCACCATCGACTTCAAGAATACGCTGATCATCAT
GACCAGCAACCTTGCGACGCACGAGATTGAATCTTTGGTTCATCAATCAAAAGACATCGATGCAAACATC
ATCGCAGAAGCTATCCGCCCTACTTTGAACCAACACTTCAAACCGGCGCTGTTGGCACGTATGTCGGTAC
TACCATTTGTTCCGCTGTCTGATGAAGCAATGACAGAAATCATTCACCATAAGCTGAACAAAGTCTCTCA
GCGTCTACAGAGCCATCACAAATTGTCTCTGAGCTACGAAGAAAGCTTGGTTGAATTCGTACTGGGTAAC
TGTCGCCTTGCTGAAACAGGCGCACGTAACATTGACGCGGTTATCAACCGTCAGTTACTGCCGCAGCTAT
CGACACAGCTATTGGTGCATGATAAGGATGATTCACATACGCAAATCGCAGTTTCTGTCGATGAGCAAGG
AACACTAACCTATGCGTTCAGCTAA