SecReT6
Protein ID: 541870626
SecReT6 ID847
T6SS typei1
Gene symbol-
Locus tagM892_22370
StrainVibrio campbellii ATCC BAA-1116
Repliconchromosome II [GenBank: NC_022270] [Browse all T6SS(s) in this replicon]
Location [Strand]1011689..1013767 [+]
ProductT6SS/ secreted protein VgrG
NoteTssI
UniProt IDA7N4N8
KEGG IDvha:VIBHAR_05870
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 9.80E-71, Aligned region: 26..332
Phage_GPD [PF05954], Evalue: 9.80E-71, Aligned region: 501..536
Phage_base_V [PF04717], Evalue: 6.50E-23, Aligned region: 311..332
Phage_base_V [PF04717], Evalue: 6.50E-23, Aligned region: 371..463
Gp5_C [PF06715], Evalue: 9.90E-06, Aligned region: 505..522
Gp5_C [PF06715], Evalue: 9.90E-06, Aligned region: 534..543
Gp5_C [PF06715], Evalue: 9.90E-06, Aligned region: 547..565
Gp5_C [PF06715], Evalue: 9.90E-06, Aligned region: 568..591
Gp5_C [PF06715], Evalue: 9.90E-06, Aligned region: 593..615
Gp5_C [PF06715], Evalue: 9.90E-06, Aligned region: 616..636
Gp5_C [PF06715], Evalue: 9.90E-06, Aligned region: 673..691
DUF2345 [PF10106], Evalue: 0.0045, Aligned region: 493..505
DUF2345 [PF10106], Evalue: 0.0045, Aligned region: 631..689
Protein Sequence: 692 a.a.     [Download]
>gi|541870626|ref|YP_008529030.1| T6SS/ secreted protein VgrG [Vibrio campbellii ATCC BAA-1116]
MVNDVEFKFEVPGCGHDFRVESFQVNEELSKPFHISLSLLSLDPDISFDALIRKAGTLTIYGQGVGAARV
FNGVVNEVRYLGTGRRFSRYQLVLVPQAWFLSQRQDCRIFQQKSAQDIITEVLDDGGVTDYRFEVSGTYP
PKEYVLQYRESDLQFVQRMMAEHGMWYYFDHTEANHTMVIVDSNDAIAPLVSSPLNASYIGPIVFHADGG
GVADREHISALELVNRVRTGQVTYTDYNYEQPKIPQEMTHAGDLDQDLKQFDYPGRYVDPAMGQVRTTEW
MSEHIVDNQQVEASSDVMRLASGYSFSISDHPRSEINRDYIMLSVMHTGQDPQVHEDETSGMPTTYYNQF
SCISRDVVFKAPKLAPPVVDGPQTAVVVGPAGEEIYTDKLGRIKVQFHWERYGDNDEHASCWIRVSQSMA
APTWGAVYLPRIGHEVVVTFLEGDPDRPLVTGAVYNGLHFPPYSLPENKTRTTFRTQTHKGTGYNELSFE
DEANQEEVYIHAQKDMSTKVLNNRYRDIGQDEFLKVARHQTNEVHGDHKETIDGHKTTQVNSTFTETVEQ
DVTVTYNANETQYVKNNSDLEIGDNRTTKIGKNDDLDVGENSNLTVGASKSSDIGADDNQTVGGNLTVSV
KGNTSYKADGATQIISGDKIVLKTGGSSLVMNSDGSIKLSGSSITIEGSDKVVVKGGNVAIN
 
Nucleotide Sequence: 2079 bp     [Download]
>gi|541870142|ref|NC_022270.1|:1011689-1013767 Vibrio campbellii ATCC BAA-1116 chromosome II, complete sequence
ATGGTGAATGACGTAGAATTTAAATTTGAAGTGCCAGGGTGTGGGCACGACTTTCGAGTAGAAAGCTTTC
AAGTGAATGAAGAGCTTTCGAAACCTTTTCACATCAGTCTCTCATTACTTTCACTTGATCCAGATATCTC
TTTTGATGCGTTAATTCGCAAAGCGGGAACGCTGACTATTTATGGACAAGGGGTAGGGGCTGCGCGCGTT
TTTAATGGCGTGGTAAACGAAGTTCGTTACCTTGGAACGGGTCGTCGCTTTTCTCGCTATCAGTTAGTTC
TTGTGCCTCAAGCTTGGTTCTTATCTCAGCGTCAAGACTGTCGTATATTCCAACAAAAATCAGCGCAAGA
CATCATCACCGAAGTACTTGATGATGGGGGCGTGACGGATTACCGCTTTGAAGTCTCTGGGACGTATCCG
CCAAAAGAGTATGTACTGCAATATCGTGAATCTGACCTTCAGTTTGTTCAGCGAATGATGGCTGAGCACG
GTATGTGGTATTACTTTGACCATACCGAAGCCAATCACACCATGGTGATTGTAGATAGCAACGACGCGAT
TGCGCCACTGGTGAGTTCACCACTCAACGCTTCTTACATCGGTCCGATTGTTTTCCATGCTGACGGTGGC
GGTGTTGCGGATCGCGAACACATCTCTGCTCTTGAGCTTGTTAACCGCGTGAGAACAGGCCAAGTTACTT
ACACCGATTACAACTACGAACAGCCTAAAATCCCTCAAGAGATGACCCACGCGGGCGATCTTGACCAAGA
TTTAAAGCAGTTTGATTACCCTGGCCGTTATGTTGACCCTGCAATGGGGCAGGTGAGAACAACAGAGTGG
ATGTCTGAGCACATCGTCGACAATCAACAAGTCGAAGCAAGCAGTGATGTGATGCGTTTGGCGTCCGGCT
ACAGCTTCAGCATTAGTGATCACCCTCGTTCTGAAATCAACCGTGATTACATCATGTTATCGGTCATGCA
CACTGGCCAAGATCCGCAAGTGCATGAAGACGAAACAAGCGGTATGCCAACCACGTATTACAACCAGTTT
TCTTGTATCTCACGTGATGTGGTGTTCAAAGCGCCAAAGCTTGCACCTCCCGTTGTTGATGGTCCACAAA
CGGCGGTAGTTGTCGGTCCTGCAGGTGAAGAGATTTACACTGATAAACTTGGGCGAATCAAAGTTCAGTT
CCATTGGGAACGTTACGGCGACAACGATGAACACGCAAGCTGCTGGATCCGTGTAAGCCAATCTATGGCT
GCGCCAACATGGGGCGCTGTTTACTTGCCACGTATTGGTCATGAAGTTGTTGTCACCTTCCTTGAGGGCG
ACCCAGATCGCCCATTAGTGACTGGCGCGGTTTATAACGGTCTTCACTTCCCTCCGTACTCGTTACCGGA
GAACAAAACTCGTACTACGTTCCGTACCCAAACGCATAAAGGCACTGGCTACAACGAACTGAGTTTTGAA
GACGAAGCGAACCAAGAAGAAGTCTACATTCACGCTCAAAAAGACATGTCGACGAAGGTACTCAACAACC
GTTATCGCGATATCGGTCAAGACGAGTTCCTAAAAGTTGCGCGACATCAGACGAACGAAGTCCATGGTGA
TCACAAAGAAACCATTGATGGCCACAAGACAACCCAAGTAAACAGCACCTTTACTGAAACCGTAGAGCAA
GATGTCACTGTTACTTACAACGCCAACGAGACTCAGTATGTGAAGAACAATTCTGATTTAGAGATTGGTG
ATAACCGCACAACCAAGATCGGCAAAAACGATGACTTGGATGTGGGCGAGAACAGCAACTTAACGGTTGG
TGCGTCGAAAAGCTCAGACATTGGTGCAGACGATAACCAAACGGTGGGTGGTAACTTAACCGTATCAGTA
AAGGGCAATACGTCTTACAAAGCCGATGGCGCAACGCAAATCATCAGTGGTGACAAGATTGTGCTGAAAA
CTGGTGGGTCTTCCTTAGTGATGAACAGTGACGGTTCAATCAAGCTTTCAGGATCTTCAATCACCATTGA
AGGCAGCGATAAAGTCGTCGTGAAGGGTGGTAACGTAGCGATTAACTAA