SecReT6
Protein ID: 541870631
SecReT6 ID847
T6SS typei1
Gene symbol-
Locus tagM892_22400
StrainVibrio campbellii ATCC BAA-1116
Repliconchromosome II [GenBank: NC_022270] [Browse all T6SS(s) in this replicon]
Location [Strand]1019822..1021423 [+]
ProductT6SS/ImpA domain protein VasJ
NoteTssA
UniProt IDA7N4P5
KEGG IDvha:VIBHAR_05864
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 2.20E-18, Aligned region: 48..108
ImpA-rel_N [PF06812], Evalue: 2.20E-18, Aligned region: 507..520
Protein Sequence: 533 a.a.     [Download]
>gi|541870631|ref|YP_008529036.1| T6SS/ImpA domain protein VasJ [Vibrio campbellii ATCC BAA-1116]
MSVIDIERLLTPISDAAPVGEDARYEFCYEMMESEVKKFGSLFGETVDWTVVKTHATEVLEQHSKDLKAI
CYLIRALTEEFGLQGFEQGLKLLSHALSQFGGELYPSRKRGRDGAVEWLNHQFKLVSSKLVESPQSWALV
SSCISTIEEVQRQYDDVYQDSEADFFEIRTQLNMLSQQAAVDGQSDDGSASEVQPEQAPSVPVSITQPEQ
TNTAVYSPKPEEAQSAPVKPLSPAPKPAPVKKAVTQEVYVDTDFSSPTASKRTLKKVAEVMIHANPSDPL
AYRIYRHLTWDDIDGLPDHQNNETPLSLAVSSDQQADYRDKANQESDIDTIKRLERTLTDAPFWLTGHHF
VYSMLNNLGFDDAAIAVKQEVKRFVDSLEGIEHLSFKNSIPFADEATLSWLSTQDAASSTSQPVVQTVVI
SEEDSLPMEDITLENLGEYAAELARKLELDSSGRGQFMLYLQLIAAYQSVGLYPLCLPYLEKGWEVQKAF
NLASWEPHLSSQLEDLIRKTLHQLFRSKDLLPEKYEEWQAIYD
 
Nucleotide Sequence: 1602 bp     [Download]
>gi|541870142|ref|NC_022270.1|:1019822-1021423 Vibrio campbellii ATCC BAA-1116 chromosome II, complete sequence
ATGTCAGTGATTGATATCGAACGTTTGCTTACGCCAATTTCTGATGCTGCTCCGGTAGGTGAAGACGCGC
GCTACGAGTTTTGCTATGAAATGATGGAATCCGAAGTGAAGAAGTTCGGCTCATTATTTGGTGAAACGGT
AGATTGGACGGTCGTTAAAACGCACGCAACAGAAGTCTTAGAACAGCACAGCAAAGATTTAAAAGCGATC
TGTTACTTGATTCGGGCACTAACGGAAGAGTTTGGCTTACAAGGTTTCGAACAAGGCTTAAAGCTGCTTA
GTCATGCGTTAAGTCAGTTTGGTGGTGAGCTTTACCCTTCGCGTAAGCGTGGTAGAGATGGCGCGGTAGA
ATGGCTTAACCATCAGTTTAAACTGGTAAGCAGTAAGTTAGTGGAAAGCCCGCAGTCTTGGGCGTTGGTT
TCAAGTTGTATTTCTACTATCGAAGAAGTGCAGCGTCAGTACGACGACGTTTATCAAGATTCAGAAGCAG
ATTTTTTTGAGATCCGTACTCAGCTCAATATGTTATCTCAGCAAGCTGCTGTCGATGGCCAGAGCGATGA
CGGCTCTGCAAGTGAAGTTCAACCTGAACAAGCGCCTTCTGTGCCGGTAAGCATTACTCAACCTGAGCAA
ACGAATACTGCTGTTTATTCGCCAAAGCCAGAAGAGGCTCAAAGCGCACCAGTTAAGCCGCTGTCGCCAG
CTCCGAAGCCAGCGCCAGTCAAGAAGGCCGTCACACAAGAAGTCTATGTTGATACGGACTTCTCATCACC
GACGGCATCGAAACGTACGCTTAAGAAAGTCGCGGAAGTGATGATTCACGCTAACCCAAGTGACCCTTTG
GCATACCGAATTTATCGTCATCTGACTTGGGATGACATTGATGGTCTTCCTGATCATCAAAACAACGAAA
CGCCATTGAGCTTGGCGGTGTCTTCGGATCAACAGGCGGACTATCGTGACAAAGCTAATCAAGAAAGCGA
CATCGACACGATTAAACGGTTGGAGCGTACATTAACTGATGCACCATTCTGGCTGACGGGGCATCACTTC
GTGTACTCGATGCTCAATAACTTGGGCTTTGATGATGCGGCCATCGCTGTAAAGCAAGAAGTGAAACGTT
TTGTTGATTCATTAGAGGGCATTGAGCACCTCTCATTTAAGAATTCTATACCATTTGCAGATGAAGCAAC
CTTGAGCTGGTTATCGACTCAAGATGCAGCTTCTTCAACTTCTCAACCTGTAGTGCAAACAGTTGTGATC
TCTGAAGAAGATTCGCTGCCGATGGAGGATATCACTCTAGAAAACCTAGGGGAATATGCCGCAGAACTTG
CCCGCAAACTCGAGCTGGATAGCTCGGGACGTGGACAGTTTATGCTGTATTTACAATTGATAGCAGCTTA
CCAGTCTGTTGGATTATACCCATTGTGTCTGCCTTATCTTGAGAAGGGTTGGGAAGTACAAAAAGCGTTT
AATCTCGCGAGCTGGGAACCCCACTTATCGTCACAGTTAGAAGACCTGATTCGAAAAACACTCCATCAGT
TATTCAGAAGTAAGGATCTTTTGCCTGAGAAGTATGAAGAGTGGCAAGCAATTTATGACTAA