SecReT6
Protein ID: 541870632
SecReT6 ID847
T6SS typei1
Gene symbol-
Locus tagM892_22405
StrainVibrio campbellii ATCC BAA-1116
Repliconchromosome II [GenBank: NC_022270] [Browse all T6SS(s) in this replicon]
Location [Strand]1021450..1021956 [+]
ProductT6SS/protein (ImpB family) VasQ
NoteTssB
UniProt IDA7N4P4
KEGG IDvha:VIBHAR_05863
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 4.50E-59, Aligned region: 5..158
Protein Sequence: 168 a.a.     [Download]
>gi|541870632|ref|YP_008529037.1| T6SS/protein (ImpB family) VasQ [Vibrio campbellii ATCC BAA-1116]
MSRDGSVAPKERINIRYVPATGDTQDDVELPLSMMVVGDFTARADETPIEERTPINIDKDNFNEVLEGMS
PNVKVNVENRLSDEEGGQIGVDLTFQNMKDFSPEAIAKSVPELNSLLELREALVALKGPLGNVPAFRKKI
ASVLQDEEARKKLLDELSIGDDQEAKEE
 
Nucleotide Sequence: 507 bp     [Download]
>gi|541870142|ref|NC_022270.1|:1021450-1021956 Vibrio campbellii ATCC BAA-1116 chromosome II, complete sequence
ATGTCACGTGACGGCTCGGTGGCTCCTAAAGAGCGAATTAATATCCGTTATGTTCCAGCAACTGGTGATA
CGCAAGACGACGTAGAACTGCCGCTGAGCATGATGGTGGTTGGTGACTTTACTGCACGTGCAGATGAGAC
GCCTATCGAAGAACGTACTCCAATCAATATCGACAAAGACAACTTTAACGAAGTGCTAGAAGGCATGTCT
CCAAACGTTAAAGTGAACGTTGAAAACCGCCTTTCTGACGAAGAAGGCGGCCAAATCGGTGTTGATCTAA
CGTTCCAAAACATGAAGGACTTCTCTCCTGAAGCGATCGCGAAAAGCGTACCTGAGCTAAACAGCTTGCT
TGAGCTTCGCGAAGCGTTGGTTGCACTGAAAGGCCCTCTAGGTAACGTTCCTGCGTTCCGTAAGAAGATC
GCATCGGTTCTTCAAGACGAAGAAGCGAGAAAGAAACTGTTGGATGAACTAAGCATTGGCGACGACCAAG
AAGCGAAAGAAGAGTAA