SecReT6
Protein ID: 541870633
SecReT6 ID847
T6SS typei1
Gene symbol-
Locus tagM892_22410
StrainVibrio campbellii ATCC BAA-1116
Repliconchromosome II [GenBank: NC_022270] [Browse all T6SS(s) in this replicon]
Location [Strand]1021965..1023440 [+]
ProductT6SS/protein (ImpC/EvpB family, DUF877) VasR
NoteTssC
UniProt IDA7N4P7
KEGG IDvha:VIBHAR_05862
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 3.90E-185, Aligned region: 66..490
Protein Sequence: 491 a.a.     [Download]
>gi|541870633|ref|YP_008529038.1| T6SS/protein (ImpC/EvpB family, DUF877) VasR [Vibrio campbellii ATCC BAA-1116]
MSAEAQAPEQEAALVESGSLLDSILNETRLKPSDEGFDVAKRGVEAFISELLSSSNTEKVDQSLVDLMIS
EIDQKLSKQVDAILHSEEVQAIESTWLGLKYLVEHTDFRENIQIELISAKKDEVLDDFEDAPEVVKSGLY
KQIYTREYGQFGGKPVGAVICDFAMSASSPDIKLMEYMANVGAMSHAPFITSASAKFFGLDSYEELPNLK
DLKSVFEGPQYAKWRGLREHEDARYLGLCTSRFMLRTPYSVEDNPIKAFDYDEQVTDGHDNYLWGNSAYA
MASKISESFAKYRWCPNIIGPQSGGAVQDLPVYNFEAMGQIETKIPTEILVSDRREYELAEEGFIALTMR
KGSDNAAFFSANSVQKPKVFANTPEGKQAEMNYKLGTQLPYMFIINRLAHYIKVLQREQIGSWKERSDLE
IELNKWIRQYVSDQENPPAEVRGRRPLRAAKVEVSDVEGDPGWYKVSMSVRPHFKYMGASFDLSLVGKLD
Q
 
Nucleotide Sequence: 1476 bp     [Download]
>gi|541870142|ref|NC_022270.1|:1021965-1023440 Vibrio campbellii ATCC BAA-1116 chromosome II, complete sequence
ATGTCTGCAGAAGCACAAGCTCCAGAACAAGAAGCAGCCTTAGTTGAATCAGGCTCACTTCTGGATAGCA
TTCTTAACGAAACTCGTTTAAAGCCAAGTGATGAAGGTTTTGACGTTGCAAAACGCGGCGTAGAAGCGTT
CATCAGTGAGCTACTAAGCAGCTCGAACACAGAGAAAGTAGACCAATCTTTGGTTGACCTAATGATCTCT
GAAATCGATCAAAAACTGTCTAAGCAAGTTGATGCGATTCTTCACAGCGAAGAAGTTCAAGCGATTGAGT
CAACGTGGCTTGGTCTTAAGTACCTTGTTGAACACACTGACTTCCGTGAGAACATTCAAATTGAACTGAT
TTCTGCGAAGAAAGATGAAGTACTTGATGACTTCGAAGACGCTCCAGAAGTGGTGAAGTCTGGCCTTTAC
AAACAGATCTACACACGTGAATACGGTCAATTTGGTGGTAAACCAGTTGGTGCTGTTATCTGTGATTTCG
CGATGTCAGCGTCCTCTCCAGATATTAAGTTGATGGAATACATGGCGAACGTGGGTGCAATGTCTCATGC
ACCTTTCATCACGTCTGCTTCGGCTAAGTTCTTTGGTCTAGATAGCTACGAAGAGCTACCAAACCTGAAA
GACCTTAAGTCAGTATTCGAAGGCCCACAATACGCGAAATGGCGCGGCCTACGTGAACACGAAGATGCAC
GTTACCTAGGTCTATGTACGTCTCGCTTTATGCTACGTACGCCTTACTCAGTAGAAGATAACCCAATTAA
GGCGTTTGACTACGATGAGCAAGTAACAGATGGCCACGATAACTACCTATGGGGCAACTCTGCGTACGCA
ATGGCTTCTAAGATCAGTGAGTCATTTGCTAAGTACCGTTGGTGTCCAAACATCATTGGTCCTCAAAGTG
GTGGTGCAGTTCAAGACCTGCCGGTTTATAACTTTGAAGCAATGGGTCAAATTGAAACTAAGATCCCAAC
TGAGATCCTTGTTTCTGACCGTCGTGAGTACGAACTAGCAGAAGAGGGCTTTATTGCTCTAACCATGCGT
AAAGGTTCTGACAACGCGGCATTCTTCTCTGCTAACTCTGTTCAAAAACCAAAAGTGTTTGCGAACACGC
CAGAAGGCAAACAAGCAGAGATGAACTACAAGCTAGGTACTCAGCTTCCTTACATGTTCATCATCAACCG
TCTGGCACACTACATCAAAGTGCTACAGCGTGAGCAAATCGGTTCTTGGAAAGAGCGTTCAGACCTAGAA
ATCGAACTGAACAAGTGGATCCGTCAATACGTTTCTGACCAGGAAAACCCGCCAGCGGAAGTTCGTGGTC
GTCGTCCACTGCGTGCTGCTAAGGTTGAGGTATCAGACGTAGAAGGCGATCCAGGCTGGTACAAAGTATC
AATGTCTGTCCGTCCTCACTTCAAGTACATGGGCGCAAGCTTCGACTTGTCTCTAGTGGGTAAACTAGAC
CAGTAA