SecReT6
Protein ID: 541870634
SecReT6 ID847
T6SS typei1
Gene symbol-
Locus tagM892_22420
StrainVibrio campbellii ATCC BAA-1116
Repliconchromosome II [GenBank: NC_022270] [Browse all T6SS(s) in this replicon]
Location [Strand]1023923..1025671 [+]
ProductT6SS/protein (ImpG, DUF879) VasA
NoteTssF
UniProt IDA7N2B1
KEGG IDvha:VIBHAR_05860
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 2.00E-191, Aligned region: 5..582
Protein Sequence: 582 a.a.     [Download]
>gi|541870634|ref|YP_008529040.1| T6SS/protein (ImpG, DUF879) VasA [Vibrio campbellii ATCC BAA-1116]
MSNSKYFQDELTYLRESGSEFAKYHPKLTHFLSEGTFDPDVERLLEGFAFLTGRIREKIDDELPELTQSL
MTLLWPHYMRSIPSLCISELKPHTGSVTEKTVVKRGAEMASEQVEGTQCLFRTCYDVNLYPITITNIEQT
NSRTSSAIDVTLSTEHGLELSRIGLDTLRLHLHGEIYVTRTVFLWLFRYLDYVELDVGGGYKHRLGPEYV
KPVGHEEDEALLPYSKNSFAGYRLLQEFFSLPEKFMFFDIQGLEWLKGIPQRSTVKVKFFFKRALPSEVV
LKDKHLRLHCTPAVNLFEKDGDPIRLEHRRNEYKVRPQSNTQDHYEVYGIEQVESWSKDERRRKPLIEFE
SFEHQINQRDKREFYKSKVGERVSGRGLERYISFHTHNGDIADLGTETVLMKLQCSNADLAERLSVGDIT
YATHKSPTYATFKNITKPTQSVSPQVNGELQWQLIANMSLNYLSLANIDVLKVLLSTYDFHSRVDRQAHR
ASIHRLDGIVSSEMKPIDRVFRGVSVRGNQFKLVTNSKFFVNEGDMFLMATVLNEFIRLYSSVNSFTELE
VFDEATGEVYNWASLIGQQTIL
 
Nucleotide Sequence: 1749 bp     [Download]
>gi|541870142|ref|NC_022270.1|:1023923-1025671 Vibrio campbellii ATCC BAA-1116 chromosome II, complete sequence
TTGAGTAACAGTAAATACTTTCAAGATGAACTCACGTATTTGCGTGAGTCGGGTAGTGAGTTTGCCAAAT
ATCATCCGAAGTTAACTCACTTTCTCTCTGAAGGAACCTTCGACCCAGACGTCGAGCGACTGCTGGAAGG
TTTCGCTTTTCTGACTGGGCGTATTCGAGAGAAGATCGACGACGAACTGCCAGAACTCACGCAATCTCTG
ATGACTTTGCTGTGGCCGCATTACATGCGTTCAATTCCGTCTTTGTGCATCAGTGAGCTAAAACCGCATA
CCGGAAGTGTTACTGAGAAAACGGTGGTAAAACGTGGTGCAGAAATGGCCAGTGAGCAAGTCGAGGGCAC
GCAATGCCTTTTCCGCACTTGCTACGATGTGAACCTATACCCAATCACGATCACCAATATTGAACAAACC
AACAGCCGCACCAGTTCAGCGATTGATGTAACGTTGTCGACGGAGCATGGTCTAGAGCTGTCTCGAATTG
GTTTAGATACGTTGCGTTTGCACTTGCATGGTGAAATTTATGTTACTCGCACTGTGTTTCTCTGGCTGTT
CCGCTACTTGGATTACGTGGAGCTGGATGTCGGTGGCGGCTACAAACATCGCTTGGGGCCAGAATATGTC
AAGCCGGTAGGGCATGAAGAAGACGAAGCGCTGCTGCCTTATAGCAAAAACTCTTTCGCAGGATACCGCT
TGTTGCAAGAGTTTTTCTCTTTGCCTGAGAAGTTCATGTTCTTCGATATTCAAGGTCTAGAGTGGTTAAA
AGGCATTCCTCAGCGCAGTACAGTGAAAGTGAAATTCTTCTTTAAGCGCGCATTGCCTTCAGAGGTTGTG
CTTAAAGATAAACACCTCAGGCTGCATTGTACCCCTGCTGTGAACTTATTTGAAAAAGATGGCGATCCAA
TTCGTTTGGAGCATCGTCGCAATGAATACAAAGTACGCCCTCAAAGCAATACTCAAGACCACTATGAAGT
CTACGGAATTGAGCAGGTCGAGAGTTGGAGCAAAGACGAGCGTCGCCGTAAACCATTGATCGAATTCGAA
TCGTTTGAGCACCAAATTAACCAGCGTGATAAGCGAGAGTTCTACAAATCAAAAGTCGGCGAGCGAGTAA
GCGGAAGAGGGTTAGAGCGCTATATTTCGTTCCATACGCATAATGGTGATATTGCGGATTTAGGTACAGA
AACTGTACTGATGAAACTGCAATGTAGCAACGCCGATCTGGCTGAGCGCCTTTCAGTGGGCGACATTACT
TACGCGACCCACAAATCGCCGACGTACGCGACATTTAAAAATATCACCAAGCCGACACAATCGGTGAGCC
CACAGGTGAACGGTGAGCTTCAGTGGCAGCTGATCGCCAATATGTCACTCAACTATTTGTCATTGGCGAA
CATTGATGTGTTGAAAGTGCTGCTCTCGACTTATGACTTCCATTCTCGTGTCGATAGACAAGCTCACCGC
GCGTCGATTCACCGACTCGATGGTATTGTGTCGTCTGAGATGAAACCGATTGACCGCGTGTTCCGTGGCG
TATCTGTACGTGGTAACCAATTTAAGCTGGTGACCAATTCGAAGTTCTTCGTAAATGAAGGCGATATGTT
CCTGATGGCAACCGTACTCAATGAATTCATCCGTTTGTATTCGAGTGTGAACTCCTTTACTGAATTGGAG
GTCTTTGATGAAGCGACAGGTGAAGTGTACAACTGGGCAAGCCTGATTGGACAGCAGACGATTCTATGA