SecReT6
Protein ID: 541870635
SecReT6 ID847
T6SS typei1
Gene symbol-
Locus tagM892_22425
StrainVibrio campbellii ATCC BAA-1116
Repliconchromosome II [GenBank: NC_022270] [Browse all T6SS(s) in this replicon]
Location [Strand]1025668..1026666 [+]
ProductT6SS/protein (ImpH, DUF1305) VasB
NoteTssG
UniProt IDA7N2B0
KEGG IDvha:VIBHAR_05859
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 2.10E-87, Aligned region: 8..317
Protein Sequence: 332 a.a.     [Download]
>gi|541870635|ref|YP_008529041.1| T6SS/protein (ImpH, DUF1305) VasB [Vibrio campbellii ATCC BAA-1116]
MITTLTDKSYEFSFYQAVLLLEKHYQLEPNSNFVAVGENKYFHQERIEFSVSPSMAFPKSDMEFITHMER
NGQQYSRVETNFLGLHGSSSPLPASYTEKLAGRDPDDNPVKDFFDFFHNRYTSLLYRVWKKYRYHVQYQS
GASDAFSGRILHLAGLSDVMQDCDVAELDRAKILSYVNQLSTRTRSPKLISGIVSHYFSLPSVRIEEWVY
RRVDIAESQRNKLNRANCVLGQTLHLGQSIADLNGKFNLCIDNIDFETFRQFSYDGELHKTLVGLMRFIL
RDPMSWDLKLTVNLDSIPENQLGNGEGNQLGQTFWLGNPGEKDAKIRLIGSI
 
Nucleotide Sequence: 999 bp     [Download]
>gi|541870142|ref|NC_022270.1|:1025668-1026666 Vibrio campbellii ATCC BAA-1116 chromosome II, complete sequence
ATGATTACAACACTTACTGATAAGTCGTATGAGTTCAGCTTCTATCAAGCGGTATTGTTGCTTGAGAAGC
ACTACCAGCTAGAGCCAAATTCTAACTTTGTCGCGGTTGGTGAGAACAAGTACTTCCACCAAGAGCGCAT
AGAGTTTAGTGTCTCGCCGAGTATGGCTTTTCCAAAGAGTGATATGGAATTTATCACTCACATGGAAAGA
AATGGGCAACAGTATTCGCGCGTCGAGACGAACTTTTTAGGTTTACATGGGTCAAGTTCGCCATTGCCAG
CGTCGTATACCGAAAAGCTTGCTGGTCGTGACCCAGATGATAACCCGGTAAAAGACTTCTTTGATTTCTT
CCACAATCGTTACACTAGCTTACTGTACCGTGTCTGGAAGAAATACCGTTATCACGTACAGTACCAAAGC
GGTGCAAGTGACGCGTTCTCAGGGCGGATCCTGCATTTGGCCGGCCTGTCTGATGTCATGCAAGATTGCG
ATGTCGCGGAGTTAGATCGAGCAAAGATCCTCTCTTATGTTAACCAGCTGTCTACCCGCACACGATCTCC
TAAGCTGATTTCCGGTATTGTTTCCCATTACTTCTCGCTACCGAGTGTACGAATCGAAGAGTGGGTGTAT
CGACGAGTAGACATTGCAGAAAGTCAACGCAACAAGCTTAACCGTGCCAACTGTGTATTAGGGCAGACCT
TACATTTGGGGCAAAGTATTGCGGATTTGAACGGCAAATTTAACTTGTGCATCGACAACATTGATTTTGA
GACGTTTAGGCAATTTTCCTACGATGGCGAGCTGCACAAGACGCTGGTGGGATTGATGCGTTTTATTCTA
CGTGACCCGATGTCTTGGGACCTTAAGCTAACTGTGAATCTCGATTCTATCCCAGAGAATCAGCTGGGTA
ATGGGGAAGGGAATCAGTTGGGTCAAACCTTTTGGCTTGGTAACCCAGGTGAGAAAGATGCCAAGATACG
TTTGATTGGTAGCATATAG