SecReT6
Protein ID: 541870637
SecReT6 ID847
T6SS typei1
Gene symbol-
Locus tagM892_22440
StrainVibrio campbellii ATCC BAA-1116
Repliconchromosome II [GenBank: NC_022270] [Browse all T6SS(s) in this replicon]
Location [Strand]1030668..1031972 [-]
ProductT6SS/ImpA domain protein VasL
NoteTssA
UniProt IDA7N2A7
KEGG IDvha:VIBHAR_05856
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 4.00E-18, Aligned region: 46..104
Protein Sequence: 434 a.a.     [Download]
>gi|541870637|ref|YP_008529044.1| T6SS/ImpA domain protein VasL [Vibrio campbellii ATCC BAA-1116]
MFFSDFARRPIDESNPSGSNPNGLDDFDEIKRQINNLNKVTGRVSWKTIQTLSKKILSTQGKDFRCSCYF
TVAATHNDGLKGLVEGLNSLLDLCVVYWYTAYPEHAKANARISAIEWMVEYTEKRIKKHRALPEELPLIE
AAHQLCLRIEEELRLHYGIKAPSFGRIRRILNQWIEEIKETKAKEAKALEVKQEKPETPSNPGGIQVNIA
PPPKTETKPTPQPQVKEAPKSSRAVVFSVIGLLVVAFASHFVYKQHKYQTLKDDIEHSSLKQLAAIVDSL
SVENKEHRIALRSATVERLDALMTDWAIDPVKVSEVNTIDELTSELTEIYPDSSSAQQLRENFLDQRSRF
ENEFDVIYKRFAYARTVFANVAKQNTDRDSKKAYEYSNSLFPLLGRIEYAEKNAQQKEIERSLLLLNAYL
YKINQLQTATNDNK
 
Nucleotide Sequence: 1305 bp     [Download]
>gi|541870142|ref|NC_022270.1|:c1031972-1030668 Vibrio campbellii ATCC BAA-1116 chromosome II, complete sequence
ATGTTTTTCAGCGACTTCGCTAGAAGGCCGATCGATGAAAGTAATCCAAGCGGCTCAAACCCTAATGGCT
TAGATGATTTTGACGAAATTAAGCGCCAGATAAATAACCTGAATAAAGTGACTGGTCGAGTATCATGGAA
AACGATTCAAACACTTTCTAAGAAAATTCTTAGTACTCAGGGGAAAGATTTTCGTTGTAGTTGCTACTTT
ACCGTGGCGGCTACGCACAACGATGGCTTGAAAGGCTTGGTTGAAGGCTTGAACTCACTGCTCGACTTAT
GTGTTGTGTATTGGTACACCGCCTACCCAGAGCACGCGAAGGCCAATGCACGTATCAGTGCCATCGAGTG
GATGGTCGAATACACTGAGAAGCGAATTAAAAAGCATCGAGCCTTACCAGAAGAGCTCCCGCTTATTGAA
GCGGCGCATCAACTGTGTTTACGCATCGAAGAAGAACTGCGCCTACATTATGGGATTAAAGCGCCATCAT
TCGGTCGCATTCGTCGTATATTGAACCAATGGATTGAAGAGATTAAAGAAACAAAAGCAAAGGAAGCTAA
AGCATTAGAAGTCAAACAAGAGAAGCCAGAAACACCATCGAATCCAGGTGGCATCCAAGTCAATATTGCG
CCGCCACCAAAAACGGAAACCAAGCCGACGCCTCAGCCGCAAGTAAAAGAAGCGCCTAAGTCCAGCCGCG
CGGTTGTATTTTCTGTTATTGGATTGCTTGTCGTTGCATTTGCTTCCCACTTTGTTTACAAGCAGCACAA
ATACCAGACTCTGAAAGATGACATTGAACACTCGTCACTAAAACAGCTAGCAGCAATCGTCGATTCATTG
AGCGTTGAGAACAAAGAACACCGCATCGCTTTACGTTCTGCGACGGTCGAACGCCTTGATGCATTAATGA
CCGATTGGGCAATCGATCCTGTAAAAGTCAGCGAAGTGAATACCATTGATGAGCTTACTAGTGAATTGAC
GGAGATCTACCCAGATTCATCATCTGCTCAGCAACTTCGAGAGAATTTTTTAGACCAACGTTCTCGTTTC
GAAAATGAATTCGATGTCATATACAAACGCTTTGCTTATGCTAGGACGGTATTTGCCAACGTAGCGAAAC
AGAACACCGACAGGGACTCGAAGAAAGCGTATGAATACAGCAATTCGCTGTTCCCGCTTCTTGGGCGGAT
TGAGTACGCAGAAAAGAATGCGCAGCAAAAGGAAATTGAACGCTCCCTCCTTTTACTGAACGCCTACCTA
TATAAGATTAATCAGTTGCAAACTGCAACAAACGACAATAAATAA