SecReT6
Protein ID: 541870638
SecReT6 ID847
T6SS typei1
Gene symbol-
Locus tagM892_22450
StrainVibrio campbellii ATCC BAA-1116
Repliconchromosome II [GenBank: NC_022270] [Browse all T6SS(s) in this replicon]
Location [Strand]1033204..1034718 [+]
ProductT6SS/FHA-containing domain protein (ImpI family) VasC
NoteFha
UniProt IDNA
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam FHA [PF00498], Evalue: 2.10E-17, Aligned region: 31..97
Protein Sequence: 504 a.a.     [Download]
>gi|541870638|ref|YP_008529046.1| T6SS/FHA-containing domain protein (ImpI family) VasC [Vibrio campbellii ATCC BAA-1116]
MQTHQLVLFISKCPEEYTGAKHVEMPEGGGSVGRAPSCTLPLTDHNRFISGTHCLISVYGDTYYISDVST
NGTMVNGNKILKNQPVSIVDGDVISLGQYEIGVSLEHVTAAQDIASDIAPERVSNDPLVNLGEAVVEEEE
KVGALEDLFTETKQDDVNTDDPIAHLKFSMQREDDHLIRDVEKPEPAKAKPVENTRQVVDDSFSIHSEFD
IPNLIPEDWLGGTATNKASVEPAAEQTKQAAFIPEDFAQTEAVPLQARRVEPEVTQPQMPQYQAPHNHAA
SNVTQRAEPVGQKWEEVTQAFIPSAQPTQPETKATENQVGFVSNDPLGAESATHSSDIGKAFYEGLGISN
PDLISNEALLFKQMGTCLRLCIDNLQKDLHEVESLKGEQGLSEADSNLAELMLTLNSQNLLSPNELVEQM
LDELNDHQIIFNKALNELLIEQSETNDPVTFANDVASKSMFTTKSKLWGEYLEFYANNRRQMNETSLKGL
IKKNYTKAIKGSHA
 
Nucleotide Sequence: 1515 bp     [Download]
>gi|541870142|ref|NC_022270.1|:1033204-1034718 Vibrio campbellii ATCC BAA-1116 chromosome II, complete sequence
ATGCAAACACATCAGCTAGTCCTATTCATTTCAAAGTGCCCGGAGGAATATACGGGCGCGAAGCATGTTG
AAATGCCAGAAGGTGGTGGTTCAGTCGGCCGAGCACCGAGCTGTACACTGCCTTTGACTGATCATAACCG
TTTCATCTCTGGCACACATTGTCTGATCAGCGTATACGGAGACACGTACTACATCAGCGATGTGTCGACC
AACGGCACAATGGTGAATGGCAACAAAATACTTAAGAACCAACCTGTGTCCATTGTTGATGGCGATGTGA
TTTCTCTGGGTCAATACGAAATTGGTGTTTCGCTAGAGCATGTCACAGCAGCGCAAGATATTGCTTCTGA
CATTGCGCCAGAACGTGTATCGAATGATCCACTCGTCAATCTCGGTGAGGCGGTTGTAGAAGAGGAAGAA
AAAGTCGGTGCATTAGAAGACTTGTTCACGGAGACCAAGCAAGATGATGTCAATACTGACGATCCTATTG
CTCATCTAAAGTTTTCGATGCAGCGTGAAGACGACCATCTTATCCGCGATGTCGAAAAGCCAGAACCTGC
AAAGGCTAAGCCAGTCGAAAACACGCGACAAGTCGTTGATGACAGCTTCAGCATCCATTCTGAATTCGAT
ATTCCAAACTTAATCCCGGAAGATTGGTTGGGAGGCACTGCCACGAATAAAGCATCTGTCGAACCCGCGG
CAGAACAAACTAAACAAGCGGCGTTCATTCCAGAAGATTTTGCGCAAACGGAAGCCGTTCCACTTCAAGC
TCGTAGGGTGGAACCAGAGGTTACCCAGCCTCAAATGCCTCAATATCAAGCGCCACATAATCACGCAGCA
TCAAACGTTACTCAAAGAGCAGAGCCTGTTGGGCAGAAATGGGAAGAGGTAACGCAAGCTTTTATTCCAT
CAGCACAACCTACTCAGCCAGAAACGAAAGCGACAGAGAACCAAGTCGGCTTTGTAAGCAATGATCCACT
AGGAGCCGAGAGCGCTACGCATTCTTCCGATATCGGTAAAGCATTTTATGAAGGTTTGGGTATTAGCAAC
CCAGATCTGATCAGCAACGAAGCTCTGTTGTTTAAACAGATGGGTACATGTCTTCGTTTATGTATCGATA
ACCTGCAAAAAGACCTGCATGAAGTTGAGTCACTCAAAGGTGAACAAGGTTTAAGTGAAGCGGATTCAAA
CTTAGCGGAGCTGATGCTGACGCTAAATAGCCAGAACTTGCTGTCTCCGAATGAATTGGTGGAGCAAATG
TTGGATGAGCTCAACGATCATCAAATTATTTTTAACAAGGCTCTCAATGAGTTGCTGATTGAACAATCAG
AGACGAATGACCCTGTCACGTTTGCAAACGACGTTGCAAGTAAATCCATGTTCACCACCAAATCAAAGCT
ATGGGGTGAGTATCTTGAGTTTTACGCCAATAACCGTCGCCAAATGAATGAGACATCATTGAAAGGCTTG
ATCAAGAAAAACTACACCAAAGCGATTAAGGGAAGCCATGCGTAG