SecReT6
Protein ID: 541870639
SecReT6 ID847
T6SS typei1
Gene symbol-
Locus tagM892_22460
StrainVibrio campbellii ATCC BAA-1116
Repliconchromosome II [GenBank: NC_022270] [Browse all T6SS(s) in this replicon]
Location [Strand]1035223..1036548 [+]
ProductT6SS/protein (ImpJ family, DUF876) VasE
NoteTssK
UniProt IDA7N4Q8
KEGG IDvha:VIBHAR_05852
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 4.30E-140, Aligned region: 19..440
Protein Sequence: 441 a.a.     [Download]
>gi|541870639|ref|YP_008529048.1| T6SS/protein (ImpJ family, DUF876) VasE [Vibrio campbellii ATCC BAA-1116]
MSLYNPVVWQDGMFMKPQHFQQLDRSQSKLSSMLSANASPLHWGIKRLEINSQLLALGKIGITRAEGILQ
DRTPFELPLLAELPEVKDVDPSIADKVVYLCCPLPSERSELFGTKKDGARYTMESQEAVDACYDSEDMAN
IVVGKLNFCLMYDHEDKSAYTSIPILKISEVKPDGSVILDESFIPTCIDIHASTVLNKFATEFASMLKHR
AESIVQRLGVVDQQGVSSVSDFMLLQALNRYEPLFWHFASAEGVHPESFYRILLQAEGELSTLCSASRRP
VEFTKYNHGDLTSCLSRTLDSAKMTLSVMSEQRAIPLTLRDQNYGIRTAAIPDSKIIDTTTFILAVKADV
TLDVLHTQFVSQTKIGSIDNIRDLINLQLPGIEIKPMPVVPRALPYHAGYTYFELDKTGEEWAALKNTAA
IAVHVAGDFANLSLQLWAVRL
 
Nucleotide Sequence: 1326 bp     [Download]
>gi|541870142|ref|NC_022270.1|:1035223-1036548 Vibrio campbellii ATCC BAA-1116 chromosome II, complete sequence
ATGTCTTTATACAATCCAGTTGTTTGGCAAGATGGAATGTTCATGAAGCCGCAGCACTTTCAGCAACTCG
ATCGTTCGCAAAGTAAACTGTCGAGCATGCTGAGCGCCAATGCGTCGCCTCTACATTGGGGAATTAAGCG
TTTAGAGATCAACTCGCAACTGCTGGCGTTGGGCAAAATTGGTATTACTCGTGCTGAAGGTATTCTTCAA
GACAGAACGCCATTCGAGTTGCCGCTGCTAGCTGAACTTCCAGAAGTGAAAGACGTTGATCCTTCGATTG
CTGACAAGGTGGTTTACCTTTGTTGTCCGCTACCTTCTGAGCGCTCTGAGCTATTCGGCACTAAGAAAGA
CGGCGCACGTTACACGATGGAATCTCAAGAGGCGGTTGACGCTTGTTATGATTCGGAAGATATGGCAAAC
ATCGTAGTCGGTAAGCTTAACTTCTGTTTGATGTATGACCATGAAGATAAGAGTGCTTACACATCGATTC
CAATTCTAAAGATCTCAGAAGTAAAGCCAGACGGCAGTGTCATCTTAGATGAGAGCTTTATCCCGACTTG
TATTGATATCCACGCTTCGACCGTACTGAACAAGTTCGCCACCGAATTCGCATCTATGCTGAAACACCGT
GCAGAATCTATCGTTCAGCGCTTAGGCGTGGTTGACCAGCAAGGCGTATCTTCGGTTTCTGATTTCATGC
TGCTACAAGCCCTAAACCGATACGAGCCGCTATTCTGGCACTTTGCAAGCGCTGAAGGGGTTCATCCTGA
GTCGTTTTATCGCATTCTTCTTCAGGCGGAAGGTGAGCTTTCGACTTTGTGTTCAGCGTCTCGTCGTCCA
GTCGAGTTCACCAAATACAACCATGGCGACCTAACCAGCTGTCTATCGCGTACATTGGATAGTGCGAAGA
TGACACTAAGTGTGATGTCTGAGCAACGTGCAATCCCTCTGACGTTGAGAGACCAAAACTACGGCATTAG
AACGGCAGCGATTCCAGACAGCAAGATCATCGATACCACAACCTTTATTCTTGCGGTTAAAGCTGATGTT
ACTTTGGATGTTCTACATACTCAGTTTGTTAGCCAAACGAAGATCGGTTCTATCGATAACATTCGTGACT
TGATTAACCTTCAACTGCCGGGCATCGAGATCAAACCAATGCCAGTTGTACCTCGAGCATTGCCTTACCA
CGCAGGTTACACCTACTTCGAACTGGATAAGACAGGCGAAGAGTGGGCGGCACTGAAAAACACGGCTGCG
ATAGCGGTTCACGTAGCCGGCGACTTTGCTAACTTGTCATTGCAACTATGGGCTGTTCGTCTATGA