SecReT6
Protein ID: 541870640
SecReT6 ID847
T6SS typei1
Gene symbol-
Locus tagM892_22465
StrainVibrio campbellii ATCC BAA-1116
Repliconchromosome II [GenBank: NC_022270] [Browse all T6SS(s) in this replicon]
Location [Strand]1036545..1037336 [+]
ProductT6SS/T4SS outer membrane protein (ImpK, DotU family) VasF
NoteTssL
UniProt IDA7N4Q7
KEGG IDvha:VIBHAR_05851
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 7.00E-55, Aligned region: 46..248
Protein Sequence: 263 a.a.     [Download]
>gi|541870640|ref|YP_008529049.1| T6SS/T4SS outer membrane protein (ImpK, DotU family) VasF [Vibrio campbellii ATCC BAA-1116]
MSYAETDVTVVLFQPEPGKPMEVMPAPDLSRNIAVQDLNIENMGINPLVDQFSWLIASLSCMSSIPWLDD
PMPFREQVAREIRKGERKLNEMELDRASILVIRYCLCAAIDESVCRQEWGANSHWSQNSLLSEFHNETSG
GDKFFVILERLKADPRKYRHVIEFLYLLLQLGFQGKYGREERGNEKLAEIGNTIYRLVRDERLAEQEKVS
LVNLKAKYLKKPLKRVISPKLILGVSAITFAIMYAATYIVIDLKFQQLLEVYR
 
Nucleotide Sequence: 792 bp     [Download]
>gi|541870142|ref|NC_022270.1|:1036545-1037336 Vibrio campbellii ATCC BAA-1116 chromosome II, complete sequence
ATGAGTTATGCAGAAACCGACGTCACCGTAGTCTTATTCCAACCAGAGCCTGGCAAACCGATGGAGGTGA
TGCCAGCGCCTGACTTATCTCGTAACATCGCGGTACAAGACTTAAACATTGAAAACATGGGCATCAACCC
TTTGGTCGATCAGTTCTCTTGGTTGATCGCCAGTTTGTCTTGTATGTCCTCAATTCCTTGGCTTGATGAC
CCAATGCCGTTTCGTGAACAAGTGGCTCGCGAGATAAGAAAAGGCGAACGTAAGCTCAATGAAATGGAAT
TGGATCGCGCATCCATTTTGGTCATCCGATACTGTTTGTGTGCTGCGATTGATGAATCGGTTTGCCGACA
AGAGTGGGGCGCTAACAGCCATTGGAGCCAGAACAGTTTGTTGTCCGAGTTCCACAATGAAACATCTGGC
GGCGATAAGTTTTTCGTTATTCTCGAGCGTTTAAAAGCAGACCCGCGCAAATACCGTCACGTCATCGAGT
TTCTCTATTTGCTGCTTCAACTTGGCTTTCAAGGCAAATACGGCCGTGAAGAGCGTGGTAACGAAAAGCT
CGCAGAAATCGGCAATACCATTTATCGCCTAGTGCGTGACGAACGTTTGGCGGAGCAAGAGAAAGTCTCT
CTGGTTAACCTTAAGGCCAAATACCTCAAGAAACCGTTAAAAAGGGTGATTTCACCCAAACTGATTTTAG
GCGTCAGTGCGATCACCTTCGCAATCATGTATGCCGCGACTTACATCGTTATAGATTTAAAGTTTCAGCA
ATTGCTTGAAGTGTATCGATAA