SecReT6
Protein ID: 541871696
SecReT6 ID847
T6SS typei1
Gene symbol-
Locus tagM892_22415
StrainVibrio campbellii ATCC BAA-1116
Repliconchromosome II [GenBank: NC_022270] [Browse all T6SS(s) in this replicon]
Location [Strand]1023502..1023912 [+]
ProductT6SS/lysozyme-related protein (DUF1316) VasS
NoteTssE
UniProt IDA7N2B2
KEGG IDvha:VIBHAR_05861
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 4.30E-21, Aligned region: 24..116
Protein Sequence: 136 a.a.     [Download]
>gi|541871696|ref|YP_008529039.1| T6SS/lysozyme-related protein (DUF1316) VasS [Vibrio campbellii ATCC BAA-1116]
MEKGYRLLERIELGEPKNCYEKVVSHKHLIESIHSHLADLLNTHSGNAMIDNEYGLPDFNDVLSNNTNLV
RHIQQNITSTIERFEPRLLNVEVHYREDHHNPLQLGFGIRGEVSHNGGKVPMSIDVYMGTDGQFNV
 
Nucleotide Sequence: 411 bp     [Download]
>gi|541870142|ref|NC_022270.1|:1023502-1023912 Vibrio campbellii ATCC BAA-1116 chromosome II, complete sequence
ATGGAAAAAGGTTATCGTCTTTTAGAGCGGATTGAGTTGGGTGAGCCCAAAAATTGCTACGAGAAAGTGG
TGTCTCATAAGCATTTGATCGAATCCATTCATTCTCACCTTGCTGACTTGCTGAATACCCACTCTGGTAA
TGCAATGATCGACAATGAATATGGCCTGCCTGATTTTAACGACGTGCTTTCCAATAACACGAACCTCGTT
CGTCACATTCAACAAAACATCACATCAACCATAGAACGCTTTGAACCGCGACTGCTGAATGTCGAGGTTC
ATTACCGTGAAGACCACCATAACCCATTACAACTCGGCTTTGGTATTCGCGGCGAAGTTTCCCATAACGG
CGGTAAAGTCCCAATGTCGATCGATGTCTACATGGGAACCGACGGCCAATTTAACGTTTAG