SecReT6
Protein ID: 541871699
SecReT6 ID847
T6SS typei1
Gene symbol-
Locus tagM892_22455
StrainVibrio campbellii ATCC BAA-1116
Repliconchromosome II [GenBank: NC_022270] [Browse all T6SS(s) in this replicon]
Location [Strand]1034762..1035211 [+]
ProductT6SS/lipoprotein VasD
NoteTssJ
UniProt IDA7N2A4
KEGG IDvha:VIBHAR_05853
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 1.50E-31, Aligned region: 12..135
Protein Sequence: 149 a.a.     [Download]
>gi|541871699|ref|YP_008529047.1| T6SS/lipoprotein VasD [Vibrio campbellii ATCC BAA-1116]
MWGQFKESTGITPETSSIELVIEASSVLNVREGGQSSPVILRVHELTSPVLFRSLDFFALFENDKASLGD
EYIKRYEYQMQPGEKIHEFLELDPATRAVGFSVAFRDIDGSSWRKVEVIEEKSEYYIKLKLEGSELISDN
TRGIEQVYF
 
Nucleotide Sequence: 450 bp     [Download]
>gi|541870142|ref|NC_022270.1|:1034762-1035211 Vibrio campbellii ATCC BAA-1116 chromosome II, complete sequence
ATGTGGGGGCAATTTAAAGAATCAACAGGCATTACGCCAGAAACGTCCTCAATCGAATTAGTGATTGAGG
CGTCTTCGGTTCTGAATGTTCGTGAAGGTGGGCAATCCTCTCCAGTTATTTTGCGAGTTCATGAGCTGAC
ATCACCCGTGTTGTTTCGCAGCTTAGACTTCTTCGCTTTGTTTGAGAACGATAAAGCATCACTGGGTGAT
GAATACATCAAACGTTATGAATACCAAATGCAGCCTGGTGAAAAGATCCACGAATTCTTGGAGCTTGACC
CAGCAACCCGTGCGGTTGGATTCTCAGTCGCGTTTCGCGATATCGACGGCTCTTCTTGGCGTAAAGTCGA
AGTGATTGAAGAGAAGAGCGAGTACTACATCAAACTCAAGTTAGAAGGCAGTGAGTTAATTTCTGACAAC
ACTCGCGGCATTGAACAAGTTTACTTTTAA