SecReT6
Protein ID: 54307861
SecReT6 ID78
T6SS typei5
Gene symbol-
Locus tagPBPRA0658
StrainPhotobacterium profundum SS9
Repliconchromosome I [GenBank: NC_006370] [Browse all T6SS(s) in this replicon]
Location [Strand]721945..723255 [+]
Producthypothetical protein
NoteFha
UniProt IDQ6LUE6
KEGG IDppr:PBPRA0658
PDB IDNA
Domain hit(s) vs Pfam FHA [PF00498], Evalue: 6.30E-13, Aligned region: 32..101
Protein Sequence: 436 a.a.     [Download]
>gi|54307861|ref|YP_128881.1| hypothetical protein PBPRA0658 [Photobacterium profundum SS9]
MDFKLSVISYHRYTSGLDVVLPLINITENNPYYIGRYELCQWCLPDPDRVISGRHALIEKRSGEIIIKDI
STNGVFINRSVEPLGDEGNYVLSVGDLITIGDYEIEVQLYSHETKKQLSGNVEDTGITGSDKELGIPSKE
LADTLSSHKDKNRSIENEVFIGDIEDSFSVPKNENEEPRSESLDESIPEDWGILFNNVDESRSQEKQIKP
EQEQFDDVNVLSEPVQIKEKSRKETVVHHIDVDGALSAFLRGMKISPTMLPTEQTEEWWFEMGESVNLLL
TGLMDTLQKRADFKQSSRLLHTSFKRQENNPLKFSANFEDAIHNLYHRKSSGFLSSQRAIQEAFSDIDKH
EKAMISGAHGAVKGVMQALNPDGIATNEIDEGLFERWYSVKKKANYWQHYESLFYELENELKQEQPFYLD
DFIKHYEASLNGIREK
 
Nucleotide Sequence: 1311 bp     [Download]
>gi|54307237|ref|NC_006370.1|:721945-723255 Photobacterium profundum SS9 chromosome 1, complete genome
ATGGATTTTAAGCTTTCAGTTATAAGTTATCATCGTTATACCTCTGGATTAGACGTTGTATTGCCTTTAA
TAAATATTACTGAAAATAATCCTTATTATATTGGGCGTTATGAGTTGTGTCAGTGGTGTTTACCTGACCC
TGATCGAGTTATTTCTGGTCGTCATGCTTTGATTGAAAAAAGGTCTGGAGAAATAATAATAAAAGATATA
TCAACAAATGGGGTTTTTATAAACCGCAGTGTTGAACCTCTTGGTGACGAAGGCAATTATGTTTTATCTG
TTGGTGATTTGATTACCATTGGTGATTATGAAATTGAAGTGCAGCTATATTCTCATGAAACAAAGAAACA
GTTATCAGGTAATGTTGAAGATACAGGAATAACAGGATCTGATAAAGAATTAGGTATTCCATCAAAAGAA
TTGGCTGATACACTTTCAAGTCATAAAGATAAAAACAGAAGCATAGAAAATGAGGTCTTCATTGGTGATA
TAGAAGATAGTTTTTCTGTACCAAAAAATGAAAATGAGGAACCCCGTTCTGAGTCACTTGATGAGAGCAT
TCCAGAGGACTGGGGGATCTTATTTAATAATGTAGATGAAAGTCGCTCACAAGAAAAACAAATTAAACCG
GAACAGGAACAATTTGATGATGTGAACGTATTATCTGAACCCGTTCAAATAAAAGAAAAATCACGTAAAG
AAACGGTTGTTCATCATATTGATGTTGATGGTGCATTATCTGCTTTTTTACGAGGTATGAAAATTAGCCC
AACAATGCTACCGACTGAACAAACAGAAGAGTGGTGGTTTGAAATGGGTGAAAGTGTAAATTTACTGCTT
ACAGGGTTGATGGATACGTTGCAAAAACGTGCTGACTTTAAACAGTCTAGTAGATTGTTGCATACGTCAT
TTAAGCGACAAGAAAATAATCCCCTTAAATTTTCAGCGAATTTTGAAGATGCAATTCATAATTTATATCA
CCGAAAATCAAGTGGTTTCTTATCTTCACAGCGTGCAATTCAAGAAGCCTTTTCTGATATAGATAAGCAT
GAAAAAGCAATGATTTCAGGTGCTCATGGTGCAGTTAAAGGTGTAATGCAAGCATTGAATCCCGATGGAA
TTGCAACGAATGAAATAGATGAAGGTTTGTTTGAACGTTGGTACTCGGTAAAGAAAAAAGCAAATTATTG
GCAACATTATGAATCATTGTTTTATGAGTTAGAAAATGAGCTGAAACAAGAGCAGCCATTCTATTTAGAT
GATTTTATTAAACACTATGAAGCTAGTTTAAATGGTATAAGGGAGAAATAA