SecReT6
Protein ID: 54307862
SecReT6 ID78
T6SS typei5
Gene symbol-
Locus tagPBPRA0659
StrainPhotobacterium profundum SS9
Repliconchromosome I [GenBank: NC_006370] [Browse all T6SS(s) in this replicon]
Location [Strand]723258..723725 [+]
Producthypothetical protein
NoteTssJ
UniProt IDQ6LUE5
KEGG IDppr:PBPRA0659
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 6.70E-36, Aligned region: 16..149
Protein Sequence: 155 a.a.     [Download]
>gi|54307862|ref|YP_128882.1| hypothetical protein PBPRA0659 [Photobacterium profundum SS9]
MPKFIKMVIVFAFMSVLLFGCSVANLVVDPYTTLEFEVSNKVNPDLNGRASPVVVKVYELQSKTIFESQD
FFMIYDESDKIFGPDLLSKDELSLSPGENFKYDLKMSSGSKYVGIVVAYRDLENSKWREIIKLDHEGYNT
HDLMVDSLSVHVKKP
 
Nucleotide Sequence: 468 bp     [Download]
>gi|54307237|ref|NC_006370.1|:723258-723725 Photobacterium profundum SS9 chromosome 1, complete genome
ATGCCTAAATTTATTAAGATGGTAATCGTTTTTGCTTTTATGTCTGTATTGTTATTTGGGTGCAGTGTTG
CAAATCTTGTTGTTGACCCTTATACAACGTTAGAATTTGAGGTGAGTAATAAAGTTAACCCTGACTTGAA
TGGTCGAGCATCGCCAGTTGTTGTTAAAGTTTATGAGTTGCAATCTAAAACGATCTTTGAAAGCCAAGAT
TTTTTTATGATTTATGATGAATCCGATAAAATATTCGGCCCAGATTTACTTTCTAAAGATGAATTGTCGT
TATCTCCGGGTGAAAATTTTAAGTATGATTTAAAAATGTCATCAGGAAGTAAATATGTAGGAATAGTAGT
TGCCTATCGAGATCTTGAAAATTCAAAATGGCGAGAAATAATTAAGTTAGACCATGAAGGATATAATACA
CATGATCTGATGGTTGATTCATTATCGGTGCATGTGAAGAAACCATAA