SecReT6
Protein ID: 54307863
SecReT6 ID78
T6SS typei5
Gene symbol-
Locus tagPBPRA0660
StrainPhotobacterium profundum SS9
Repliconchromosome I [GenBank: NC_006370] [Browse all T6SS(s) in this replicon]
Location [Strand]723881..725206 [+]
Producthypothetical protein
NoteTssK
UniProt IDQ6LUE4
KEGG IDppr:PBPRA0660
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 1.20E-143, Aligned region: 19..439
Protein Sequence: 441 a.a.     [Download]
>gi|54307863|ref|YP_128883.1| hypothetical protein PBPRA0660 [Photobacterium profundum SS9]
MSNWGRVAWSEGMFLRPQHFQQQERYLLNEYSEVINNVTPYAWGISHLSIDNALLSQSLISVNDIKAVMP
DGQLVFSPKRDRLPIPLVIDKSVRNEIVVIAVPIDKPHATNISTQEDSQVTRYFFQDFNVVDNSGGMDEE
ILQLAALAIELKLDSERLNGYYTVPIARIIEVTEEGKVILDTSFIPPTLSAQNNPNIKQLLSDMIGKVKL
RADTLASRLNQSQGNATSIADFLMLQMLNRYEPILKHLVSIEGTHPESICRVLYGMAGELATYSSSRKRP
SELPVYSHLGLTEVFGRLSVVLNQCLSTVLEQTAVQIPIETTKFGIRVASVPDKTLLTRSQFVLAIKADI
EPEELRRRFPTQVKIGPVEHIRDLVNNQLQGIAVDALPVAPRQVPYHAGFHYFQLDKSNDYWARLSASGG
IAIHLSGNYPSLSMQCWSVNQ
 
Nucleotide Sequence: 1326 bp     [Download]
>gi|54307237|ref|NC_006370.1|:723881-725206 Photobacterium profundum SS9 chromosome 1, complete genome
ATGAGTAACTGGGGACGCGTTGCTTGGTCTGAAGGGATGTTCTTACGCCCTCAGCATTTCCAACAACAAG
AGCGATATTTATTAAATGAATATTCTGAGGTTATAAATAATGTCACTCCTTACGCTTGGGGTATTTCTCA
TTTATCAATTGACAATGCATTGTTATCGCAAAGCTTAATATCTGTAAACGATATCAAAGCAGTGATGCCT
GATGGCCAATTAGTTTTTTCGCCTAAAAGAGATAGGCTGCCTATCCCCCTTGTTATTGATAAATCCGTTA
GAAATGAAATTGTCGTTATTGCTGTGCCAATAGATAAACCTCATGCGACTAATATCTCTACACAAGAAGA
TAGCCAAGTTACTCGATATTTTTTTCAAGACTTTAATGTAGTAGATAATAGTGGAGGAATGGATGAAGAA
ATTCTTCAACTGGCTGCATTGGCTATTGAGTTAAAACTAGATAGTGAGCGATTGAATGGTTATTACACGG
TTCCAATTGCCCGTATTATTGAGGTGACAGAAGAAGGTAAGGTAATCCTTGATACTTCTTTTATACCGCC
AACGTTAAGTGCACAGAATAATCCCAATATAAAACAATTACTGTCAGATATGATCGGTAAGGTGAAACTT
CGTGCGGATACACTGGCAAGCAGGTTGAATCAGTCCCAAGGGAATGCAACGTCAATCGCAGATTTTCTTA
TGCTGCAAATGCTGAATCGTTATGAGCCGATCCTTAAACATTTAGTGTCGATTGAAGGTACGCACCCGGA
ATCAATATGTCGGGTGCTTTATGGCATGGCTGGTGAATTGGCAACGTATTCTAGCAGCCGTAAGCGTCCT
TCCGAGCTTCCTGTGTATTCTCATCTGGGCTTAACAGAGGTATTTGGACGTTTATCTGTCGTACTTAATC
AGTGCTTAAGTACGGTACTTGAGCAAACAGCCGTTCAAATCCCAATTGAAACGACTAAGTTTGGTATTCG
AGTTGCGTCAGTACCAGACAAGACGTTACTTACGCGAAGTCAGTTTGTTTTGGCTATTAAAGCCGATATT
GAACCAGAAGAGCTTCGTCGTCGTTTTCCTACTCAGGTGAAAATTGGCCCTGTTGAGCATATCCGTGATT
TGGTGAACAACCAACTCCAAGGCATTGCTGTTGACGCATTACCAGTGGCGCCAAGGCAGGTTCCTTATCA
TGCAGGTTTCCATTATTTCCAGTTAGATAAAAGTAATGATTATTGGGCGCGTTTGAGTGCAAGTGGTGGG
ATTGCTATCCACCTCTCGGGTAATTATCCATCGCTTAGCATGCAATGTTGGTCTGTTAACCAATAA