SecReT6
Protein ID: 54307864
SecReT6 ID78
T6SS typei5
Gene symbol-
Locus tagPBPRA0661
StrainPhotobacterium profundum SS9
Repliconchromosome I [GenBank: NC_006370] [Browse all T6SS(s) in this replicon]
Location [Strand]725233..726552 [+]
Producthypothetical protein
NoteTssL
UniProt IDQ6LUE3
KEGG IDppr:PBPRA0661
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 5.20E-66, Aligned region: 55..259
OmpA [PF00691], Evalue: 5.40E-14, Aligned region: 326..424
Protein Sequence: 439 a.a.     [Download]
>gi|54307864|ref|YP_128884.1| hypothetical protein PBPRA0661 [Photobacterium profundum SS9]
MSDETVLKPQPGKRKAKVASPESHSKVQPDLNQTVLVMQVNKNLYSKRLPSLGENPLVDLASSLLSLVGQ
IRCTPDHSDVGFLRQACIEKIRDYENNLRGLAVSVSDIEAARYCLCTFLDETILNTPWGEHSVWRSESLL
SVFNKETWGGEYFYTLLDEALSSPHQSYQLLELQYLCLALGFTGKLRIAERGEEKLQDYRCQIFEALTLV
KGSHDEALSPRWQDNVLAGSETHAGVPLWVTSSLFGLLLLAVYMGFNYRINLYSNEAFQSLSTLVPMVVE
SSNLEYHRDPAALKIQQLLQSEVERGLLEFEEHADRIRIVLNSNDLFASGSNEVKASIAPILSKIAHTLE
STNGRIMIVGHTDDKPIFTSKYPSNWHLSLARATAVANVLAMGTELRGRLWPEGQGDANPRNPNTSKANR
ASNRRVEIDLLYQQRRAEK
 
Nucleotide Sequence: 1320 bp     [Download]
>gi|54307237|ref|NC_006370.1|:725233-726552 Photobacterium profundum SS9 chromosome 1, complete genome
ATGTCAGATGAAACCGTTCTGAAGCCGCAACCAGGAAAGCGAAAAGCGAAGGTTGCTTCACCAGAAAGTC
ATTCCAAGGTGCAGCCTGATTTAAATCAGACTGTATTGGTTATGCAGGTCAATAAAAACCTTTATTCGAA
ACGTCTACCTTCGTTAGGTGAAAATCCATTGGTTGATCTCGCCAGTAGTTTACTATCGTTAGTTGGGCAA
ATTCGATGTACGCCTGATCACAGTGATGTGGGTTTTCTTCGTCAAGCATGTATAGAAAAGATACGAGACT
ATGAAAATAATCTTCGTGGATTAGCTGTATCGGTTAGTGACATAGAAGCCGCGAGATATTGTCTGTGTAC
ATTTCTTGATGAAACTATTTTGAACACCCCTTGGGGCGAGCATTCAGTCTGGCGTTCAGAGAGCTTACTC
TCTGTATTTAATAAAGAAACATGGGGTGGAGAATATTTCTATACCTTGTTAGATGAGGCTCTTTCTAGCC
CCCACCAATCCTATCAACTGCTTGAATTACAATACCTATGCTTAGCATTGGGTTTTACAGGAAAACTACG
TATTGCTGAGCGTGGTGAAGAAAAACTGCAAGATTATCGCTGCCAAATTTTTGAAGCCTTAACTCTTGTG
AAGGGATCACATGATGAAGCGTTATCCCCAAGGTGGCAAGACAACGTATTAGCGGGTAGTGAAACCCATG
CTGGCGTCCCTTTATGGGTAACATCATCACTTTTTGGTTTGTTATTATTGGCCGTTTATATGGGCTTTAA
CTACCGTATTAATCTTTACTCCAATGAAGCTTTTCAGTCTCTGAGCACACTTGTACCCATGGTTGTTGAA
TCTTCAAATTTGGAATATCACAGAGATCCCGCGGCCTTAAAAATACAGCAGTTACTACAGTCTGAGGTTG
AACGAGGTTTACTTGAATTTGAAGAACACGCGGATCGGATTCGTATTGTTTTGAATTCCAATGATTTGTT
TGCCTCTGGTAGCAATGAAGTTAAAGCTTCTATAGCCCCTATACTGTCTAAAATTGCCCATACGCTTGAA
TCGACAAATGGCCGGATAATGATCGTGGGTCATACTGATGATAAGCCAATATTTACCAGCAAATATCCCT
CTAATTGGCATCTGTCGTTAGCTAGAGCGACGGCTGTTGCTAACGTACTCGCGATGGGAACTGAGCTTCG
AGGCCGTTTATGGCCTGAAGGTCAGGGTGATGCGAATCCACGTAATCCAAATACGAGCAAAGCGAATCGA
GCAAGTAATCGACGCGTTGAAATTGATCTTTTATATCAACAACGAAGGGCTGAAAAATAA