SecReT6
Protein ID: 54307868
SecReT6 ID78
T6SS typei5
Gene symbol-
Locus tagPBPRA0665
StrainPhotobacterium profundum SS9
Repliconchromosome I [GenBank: NC_006370] [Browse all T6SS(s) in this replicon]
Location [Strand]731589..732722 [+]
Producthypothetical protein
NoteTssA
UniProt IDQ6LUD9
KEGG IDppr:PBPRA0665
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 2.20E-18, Aligned region: 71..132
Protein Sequence: 377 a.a.     [Download]
>gi|54307868|ref|YP_128888.1| hypothetical protein PBPRA0665 [Photobacterium profundum SS9]
MAIQPLEQSEMIDFSALLTAINDEKPSGEDPRRDASPSSLYYLLKNVRNNVRTEERNALIEGDPLLSFAS
QWQPLLDQVPEILTTQSKDLEYTAWFIEALVRNHGYAGLSYGFSVAKLLIDEFWDSLYPLPDEDGAETRV
APLIGLNGIEGEGTLLMPIACIPITEFDGDQAYALWEYEQACELERFDDDKKRHRIDQGSIDMKRVVEAV
KHSSPSFYRGLVDDIENSISAYEALVVSMDQATGLSLPTSHISKRLQSALESVQHIAADKLLQDVPEEVG
DVSNDGGHDEKLTDSQSENFASRQLKTRQEAIVQLKHISVFFRKTEPHSPMSYAIDQVVRWSDLALPDLL
AELIDDGSARQGYFRLVGISSENDTAS
 
Nucleotide Sequence: 1134 bp     [Download]
>gi|54307237|ref|NC_006370.1|:731589-732722 Photobacterium profundum SS9 chromosome 1, complete genome
ATGGCAATACAACCACTTGAACAGTCTGAAATGATCGACTTCTCTGCATTATTGACAGCGATTAATGATG
AAAAGCCAAGCGGAGAGGATCCAAGACGAGATGCGTCACCATCGTCTTTATATTATCTGCTAAAAAATGT
GCGCAATAACGTTCGTACAGAAGAGCGTAATGCCTTAATTGAAGGTGATCCTTTATTGAGTTTTGCGAGT
CAATGGCAGCCTTTATTAGACCAAGTACCTGAAATATTAACAACGCAATCGAAAGACCTTGAATACACCG
CATGGTTTATTGAAGCACTGGTACGAAATCATGGTTACGCCGGGCTGAGTTATGGTTTTTCAGTGGCAAA
GCTATTGATTGATGAATTCTGGGATTCTTTATACCCACTACCCGATGAAGACGGTGCTGAAACTCGGGTT
GCTCCGCTAATTGGCCTTAATGGGATTGAAGGTGAAGGCACATTACTCATGCCGATTGCGTGTATCCCGA
TCACCGAGTTTGATGGTGATCAAGCCTATGCCCTATGGGAGTACGAGCAAGCCTGTGAACTTGAGCGCTT
TGATGATGATAAAAAGCGCCACCGTATAGACCAAGGTTCTATTGATATGAAACGTGTGGTGGAAGCGGTT
AAGCATTCATCGCCATCGTTTTATCGTGGATTAGTCGACGATATTGAAAACAGTATTTCTGCTTATGAAG
CTTTAGTGGTGTCGATGGATCAAGCGACAGGGCTGTCATTACCCACCTCTCATATTTCAAAACGACTGCA
ATCGGCGCTGGAATCGGTACAGCATATTGCCGCCGATAAGTTGCTTCAAGATGTACCTGAAGAGGTTGGT
GATGTATCGAATGACGGTGGGCATGATGAAAAACTTACTGATTCACAAAGTGAAAACTTCGCATCGCGTC
AGTTAAAAACGCGGCAAGAAGCGATTGTTCAATTGAAGCATATATCAGTTTTTTTTCGCAAAACAGAGCC
TCATTCACCGATGTCGTATGCCATTGATCAGGTGGTGAGATGGAGCGATTTAGCATTACCCGATTTATTG
GCTGAGCTGATTGATGATGGCTCAGCGAGACAAGGTTATTTCAGGTTGGTTGGCATTTCTTCTGAAAATG
ACACCGCATCATAA