SecReT6
Protein ID: 54307869
SecReT6 ID78
T6SS typei5
Gene symbol-
Locus tagPBPRA0666
StrainPhotobacterium profundum SS9
Repliconchromosome I [GenBank: NC_006370] [Browse all T6SS(s) in this replicon]
Location [Strand]732758..733291 [+]
Producthypothetical protein
NoteTssB
UniProt IDQ6LUD8
KEGG IDppr:PBPRA0666
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 4.70E-60, Aligned region: 8..162
Protein Sequence: 177 a.a.     [Download]
>gi|54307869|ref|YP_128889.1| hypothetical protein PBPRA0666 [Photobacterium profundum SS9]
MESIHKKLSRVRKPRVHITYDVETEGLTVKKELAFVVGVMGDFAGQNTEALKPLKDRRFIQIDRDNFDDV
LKRMSPRLNFKVDNKLMNDGTELSLSLAFNSMQDFEPAAIVNQVEPLKKLLETRTKLRDLMTKIDRSEDL
ENVLEKVLNNTDNLSQLANELNVGNDNPEKQPEGEGA
 
Nucleotide Sequence: 534 bp     [Download]
>gi|54307237|ref|NC_006370.1|:732758-733291 Photobacterium profundum SS9 chromosome 1, complete genome
ATGGAAAGTATCCACAAGAAGTTGTCTCGGGTACGAAAACCGCGTGTTCACATTACTTATGATGTGGAAA
CTGAAGGATTAACGGTCAAAAAAGAATTGGCCTTCGTCGTGGGTGTAATGGGGGACTTTGCGGGTCAAAA
TACCGAGGCATTGAAGCCATTAAAAGATCGACGCTTTATACAAATTGATCGTGATAATTTCGACGATGTT
CTTAAGCGTATGAGCCCTCGCTTAAACTTCAAAGTTGATAATAAATTAATGAATGATGGCACTGAGTTGA
GTCTTTCTTTGGCATTTAATTCAATGCAAGATTTTGAGCCTGCGGCCATAGTTAATCAAGTTGAACCACT
GAAAAAGTTGCTTGAAACGCGTACTAAACTGCGCGATTTAATGACAAAAATTGATCGTTCAGAAGATCTT
GAAAATGTATTAGAAAAAGTATTGAACAATACGGATAACCTGTCTCAATTGGCTAACGAATTAAATGTAG
GTAATGACAATCCAGAGAAGCAGCCTGAAGGAGAAGGTGCCTAA