SecReT6
Protein ID: 54307870
SecReT6 ID78
T6SS typei5
Gene symbol-
Locus tagPBPRA0667
StrainPhotobacterium profundum SS9
Repliconchromosome I [GenBank: NC_006370] [Browse all T6SS(s) in this replicon]
Location [Strand]733291..734781 [+]
Producthypothetical protein
NoteTssC
UniProt IDQ6LUD7
KEGG IDppr:PBPRA0667
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 3.60E-188, Aligned region: 63..493
Protein Sequence: 496 a.a.     [Download]
>gi|54307870|ref|YP_128890.1| hypothetical protein PBPRA0667 [Photobacterium profundum SS9]
MNAQTEALLDPATAETSRSFLEEAIVATKQTDSSRAEELLRTLTEEALKGTVTWNKNLTVTFNDAIKGID
DAISSQLAEIMHQPEFQKLEGSWRGLHYLAMNSDTGQTLKIRMLSLSKKELHKDLSKAVEFDQSQIFKKV
YEAEFGTPGGEPYGALIGDYEFTNHPEDIEMLGLMSNVAAAGFSPFLSAASPELFGFDEWEELSKPRDLD
KVFESLEYTQWRSFRESPDSRFVTLTMPRVLSRLPYGQTTLPIEEFRYEELTIDDESGLAINAKHDDYCW
MNASYVMGAKMTAAFSKYGFCTAIRGAEGGGKVDNLPAHVFMSDDGDPDLKCPTEVGITDRRESELGRLG
FLPLCHYKNTNYAVFFGGQTCQKPTKFDTLEASANAEISARLPYMMATSRFAHYLKVMARDKIGSFMEAD
DVERWLNRWILSYVNATEDAGQEIRAKYPLADAKVKVQEIPGQPGAYHAVAWLRPWLQMEELTTSLRLVA
KIPEIS
 
Nucleotide Sequence: 1491 bp     [Download]
>gi|54307237|ref|NC_006370.1|:733291-734781 Photobacterium profundum SS9 chromosome 1, complete genome
ATGAATGCACAAACAGAGGCATTACTCGATCCTGCAACAGCAGAAACCAGTCGATCTTTCCTTGAGGAAG
CTATTGTTGCCACTAAGCAAACAGACAGCTCTCGTGCCGAAGAATTGTTACGTACGTTAACGGAAGAAGC
GCTAAAGGGAACGGTGACTTGGAATAAAAACCTAACAGTGACCTTTAATGATGCCATTAAGGGAATTGAT
GATGCTATTTCATCACAACTTGCCGAGATCATGCACCAACCTGAATTTCAGAAGCTTGAAGGCAGTTGGC
GTGGTCTGCACTATCTTGCAATGAACTCGGATACTGGACAAACATTGAAAATTCGGATGCTGAGTCTGAG
TAAGAAAGAGCTACATAAAGATTTAAGTAAGGCTGTTGAATTTGATCAAAGCCAGATTTTCAAAAAGGTT
TATGAGGCTGAATTTGGTACACCAGGTGGAGAACCATACGGTGCATTAATTGGTGATTATGAATTTACTA
ATCATCCGGAAGATATTGAAATGCTGGGCTTAATGTCAAATGTTGCAGCGGCTGGTTTCTCTCCCTTCTT
ATCTGCGGCTTCACCTGAACTATTTGGTTTTGATGAGTGGGAAGAGTTAAGCAAACCAAGAGATTTAGAT
AAAGTGTTTGAGTCGCTTGAATATACACAATGGCGATCATTCCGTGAAAGCCCTGACTCACGTTTTGTCA
CCTTAACAATGCCACGAGTATTGTCGCGTTTACCTTATGGCCAAACGACGTTGCCAATTGAAGAATTCCG
CTACGAAGAGTTAACGATTGATGATGAAAGTGGTTTGGCCATTAACGCTAAGCATGATGATTATTGTTGG
ATGAATGCCTCGTATGTAATGGGCGCGAAGATGACGGCCGCGTTCTCTAAATATGGCTTTTGTACCGCGA
TTCGCGGGGCTGAAGGAGGAGGAAAAGTTGATAATCTTCCGGCTCATGTTTTTATGAGTGATGATGGTGA
CCCAGATTTGAAATGTCCGACTGAAGTTGGCATTACCGATCGCCGTGAGTCGGAACTGGGTAGATTGGGT
TTCTTACCGTTATGTCATTATAAAAATACTAACTATGCTGTGTTCTTTGGTGGCCAAACATGTCAAAAGC
CAACTAAATTTGACACGCTAGAAGCATCGGCAAATGCGGAAATTTCGGCGCGTTTACCGTATATGATGGC
AACATCACGTTTTGCCCATTATTTGAAAGTAATGGCACGTGACAAAATTGGTAGCTTCATGGAAGCGGAT
GATGTTGAGCGCTGGTTAAACCGTTGGATTTTATCTTATGTCAATGCAACTGAAGATGCAGGGCAAGAAA
TTCGCGCGAAATATCCACTAGCTGATGCAAAAGTAAAAGTACAAGAAATTCCTGGCCAGCCAGGTGCTTA
CCATGCGGTTGCTTGGTTACGTCCTTGGTTACAAATGGAAGAGTTGACCACTTCATTGCGTCTTGTCGCA
AAAATACCTGAAATTAGTTAA

Protein ID: 54307871
SecReT6 ID78
T6SS typei5
Gene symbol-
Locus tagPBPRA0668
StrainPhotobacterium profundum SS9
Repliconchromosome I [GenBank: NC_006370] [Browse all T6SS(s) in this replicon]
Location [Strand]734842..736383 [+]
Producthypothetical protein
NoteTssC
UniProt IDQ6LUD6
KEGG IDppr:PBPRA0668
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 1.30E-162, Aligned region: 73..505
Protein Sequence: 513 a.a.     [Download]
>gi|54307871|ref|YP_128891.1| hypothetical protein PBPRA0668 [Photobacterium profundum SS9]
MSINTLSFISEQDLTHSKLALSERYNCYAESQLVDSFLDTEDEDLALKMWLDIHDVVNIKNTNKSELISL
ILSAISSIDEKVNSQVNEILHHVSFKKLEASWLGLKYLAEQEHEYDTEQKCKIKLLHLTWQELSRDCAKA
IDFDQGEFFRIIYNNEFNIAGGEPFGLLIGDYKITHQVQKNITVNDVDTLRIVMQTAAAAFAPFITSADP
SLLGVDAFSELASINNIDSHFEQLEYINWQNLRKMEDAKFLGLTLPDILLRSPYEPDGSRREGFLFKESN
QFTDTDYLWGNAAYSFAAVTIRAYCESGWFSHIRGIQSGKYRQGLVVKVPQSHFCVTRRLTKNKMSVNLQ
VGDKLEKQLADNGFIPVASVSETEFLSFYSNASVNEPKKYTSTSDTINARLASMLQYILCVSRFAHYIKV
MGRDRIGSFESAEQIEHYFQRWLHSYTTSTEEVSDEIRARFPLSEARIQVKETVGKSGHYYSVVHLRPHF
QLDQMISNIRLITELSPILNRNG
 
Nucleotide Sequence: 1542 bp     [Download]
>gi|54307237|ref|NC_006370.1|:734842-736383 Photobacterium profundum SS9 chromosome 1, complete genome
GTGTCAATAAATACACTCTCTTTTATATCAGAACAAGATTTAACACATAGCAAACTGGCACTGTCTGAAC
GGTATAATTGTTATGCTGAAAGTCAATTAGTGGATAGCTTTCTTGATACAGAGGATGAAGATCTTGCACT
TAAAATGTGGCTAGATATTCATGATGTAGTCAATATTAAAAATACCAATAAGAGTGAATTGATATCTTTA
ATATTATCTGCAATTTCATCTATTGATGAGAAAGTAAATAGTCAGGTTAATGAGATTTTACATCATGTTT
CATTTAAAAAGTTAGAAGCCAGTTGGTTAGGGTTGAAATATTTAGCTGAGCAAGAACATGAATATGATAC
AGAACAGAAGTGTAAAATAAAATTACTTCATTTAACGTGGCAGGAATTAAGCCGTGATTGTGCAAAAGCT
ATCGATTTTGATCAAGGTGAATTTTTTCGAATTATCTATAATAATGAATTTAACATTGCAGGTGGTGAAC
CTTTTGGTTTGTTAATTGGTGATTATAAAATTACTCATCAAGTTCAGAAAAACATCACTGTAAATGATGT
TGATACCTTAAGAATAGTGATGCAAACGGCTGCGGCTGCGTTTGCACCATTTATTACTTCTGCTGATCCT
AGCCTTTTAGGCGTTGATGCTTTTTCTGAATTAGCATCTATTAATAATATTGATAGTCATTTTGAGCAGC
TAGAATATATTAATTGGCAAAATTTAAGAAAGATGGAAGATGCTAAGTTTTTAGGTCTTACTTTGCCCGA
TATTCTTTTGCGCTCACCTTATGAACCGGATGGTTCGCGGCGAGAAGGTTTCTTATTTAAAGAATCTAAT
CAGTTTACAGATACAGACTACCTTTGGGGGAATGCGGCATATAGTTTTGCCGCAGTCACAATACGGGCCT
ACTGTGAGTCTGGTTGGTTTTCGCATATACGAGGCATACAGTCTGGCAAGTATCGACAAGGTTTGGTTGT
TAAGGTGCCTCAGAGTCATTTTTGCGTTACTCGTCGATTAACAAAAAATAAGATGTCAGTGAATTTACAA
GTCGGTGATAAGCTTGAAAAACAATTAGCAGATAATGGTTTTATACCTGTGGCATCTGTTTCAGAAACTG
AATTTTTATCATTTTATAGCAATGCGTCAGTGAATGAACCTAAAAAATACACATCGACTTCAGATACAAT
AAATGCACGTTTAGCGTCGATGCTTCAATATATATTGTGTGTTTCAAGATTTGCTCATTATATAAAAGTG
ATGGGGCGAGATCGCATCGGTAGCTTTGAGAGTGCAGAACAAATCGAACATTACTTTCAGCGATGGTTGC
ATTCGTATACCACATCGACCGAAGAAGTATCTGATGAGATAAGAGCACGGTTTCCATTAAGCGAGGCCAG
AATTCAGGTGAAAGAAACGGTTGGAAAATCAGGTCACTATTATTCTGTGGTTCATTTACGGCCACACTTC
CAGCTGGATCAGATGATATCAAACATAAGATTAATAACCGAACTGTCACCAATATTAAATCGTAATGGAT
AA