SecReT6
Protein ID: 54307872
SecReT6 ID78
T6SS typei5
Gene symbol-
Locus tagPBPRA0669
StrainPhotobacterium profundum SS9
Repliconchromosome I [GenBank: NC_006370] [Browse all T6SS(s) in this replicon]
Location [Strand]736388..737182 [+]
Producthypothetical protein
NoteTagJ
UniProt IDQ6LUD5
KEGG IDppr:PBPRA0669
PDB IDNA
Domain hit(s) vs Pfam ImpE [PF07024], Evalue: 7.30E-38, Aligned region: 138..258
Protein Sequence: 264 a.a.     [Download]
>gi|54307872|ref|YP_128892.1| hypothetical protein PBPRA0669 [Photobacterium profundum SS9]
MLNVNSRLQNESISDIISDYIQQLKNTPSNSDVRSDFIELLCIDGQLERADQQLSLLIQQCPEYLVGGNN
LRQLIHAAQARVDFFNGNATAKLLVGDQDSFQHFVELIFARNQGLVEQVIHHTTQLDAKRKPAPLTVNGV
AYDDCRDLDDLLAGYLEVFGTDGQYYLLPFSSIHRLQFMPISSLVEMTWRKVDIDVIDGPSGDAFIPMTY
LTSLTDAEKLGKETDWREISSTPVVIGLGQKMWLVGEEAMAVMQCELIEGTAVN
 
Nucleotide Sequence: 795 bp     [Download]
>gi|54307237|ref|NC_006370.1|:736388-737182 Photobacterium profundum SS9 chromosome 1, complete genome
ATGTTAAATGTTAATAGCCGTCTTCAGAATGAAAGTATCTCTGATATTATTTCAGATTACATTCAGCAGT
TAAAAAACACACCAAGTAATAGTGATGTACGCAGTGATTTTATTGAATTACTGTGTATCGATGGCCAACT
AGAACGTGCAGATCAGCAGTTGTCGTTATTAATACAACAATGTCCTGAATATTTGGTTGGTGGTAATAAT
TTACGTCAACTTATTCATGCAGCTCAAGCAAGGGTCGATTTTTTTAATGGCAATGCCACGGCAAAACTAT
TAGTCGGTGACCAAGATTCATTCCAGCACTTTGTTGAATTAATATTCGCCAGAAATCAAGGGTTGGTGGA
ACAAGTTATTCATCATACAACGCAATTAGACGCCAAGCGTAAACCTGCACCTTTAACCGTTAATGGGGTT
GCTTACGACGATTGTCGTGATCTTGATGATTTATTAGCGGGTTATCTCGAAGTGTTTGGCACGGATGGAC
AATACTATCTTTTGCCATTTTCTTCCATCCATCGCCTTCAATTCATGCCGATCTCTTCGTTAGTCGAAAT
GACTTGGCGTAAAGTTGATATTGACGTAATTGATGGGCCAAGTGGAGATGCGTTCATCCCAATGACTTAC
CTGACGAGTTTAACTGATGCAGAGAAACTAGGGAAAGAAACGGATTGGAGAGAAATATCATCGACTCCTG
TTGTTATTGGCCTAGGGCAAAAAATGTGGCTGGTCGGTGAAGAGGCGATGGCTGTAATGCAATGTGAATT
AATTGAAGGCACAGCTGTAAATTGA