SecReT6
Protein ID: 54307874
SecReT6 ID78
T6SS typei5
Gene symbol-
Locus tagPBPRA0671
StrainPhotobacterium profundum SS9
Repliconchromosome I [GenBank: NC_006370] [Browse all T6SS(s) in this replicon]
Location [Strand]737674..739503 [+]
Producthypothetical protein
NoteTssF
UniProt IDQ6LUD3
KEGG IDppr:PBPRA0671
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 1.60E-190, Aligned region: 5..609
Protein Sequence: 609 a.a.     [Download]
>gi|54307874|ref|YP_128894.1| hypothetical protein PBPRA0671 [Photobacterium profundum SS9]
MSDDLLKYYNRELAYMRRIGAEYAEKHPKIAGRLRLSEDQVEDPHASRLIEAFSLLTAQIRRNLDDNYPQ
LTEALIGQLYPDYHATLPPMSVIKLSAKDNINVGFTIDKSESVELVANHFKRCQFQTCYQTLLWPFDVSA
ATFENAPFHAPEAKFPKTACSVLKLTVTGADEQHVLSGFDFNSIRFYLNGLPHISYQLYQFLLRSAVGIA
IVPKGNEQAIKYLSAKHLQATGFDDDQAVIPYSKQSFSGYRLLVEYFLLPEKFLFIELNQLDSSWFGDSD
QADIYIYFDEPSDVMPKQLTKDNILLGCTPIINLFEKQVEPIALDNVAYEYPITPSYNQSEANEVISIER
VKAYNWNNTELDVMPFYGGEHPIYPAGSELFWSIRREDVNWAGGFDEPGRETYISIVDRNTKGFEPSNND
RWSLKIETLCSNRNLASRLPFGGGQPKVFLAKHGDAFEGVRCLFAPTEPVRPRLHDSTRWQLSKLITLNT
FTSGDSLSTLKETLRLYDFKASPQTKVLIDAIVGLKISPATARVNQKGRVGFCHGSDIDLTFTASDVQEP
TIFLFSHVIAHFFAQYAAVNSFTRLRVWLKGQEQPFYEWPAAAGGQVLL
 
Nucleotide Sequence: 1830 bp     [Download]
>gi|54307237|ref|NC_006370.1|:737674-739503 Photobacterium profundum SS9 chromosome 1, complete genome
ATGAGCGATGATTTACTGAAGTATTATAATCGTGAACTGGCTTATATGCGTCGAATAGGGGCTGAATATG
CAGAGAAGCACCCAAAAATAGCGGGTAGATTGCGATTAAGTGAAGATCAAGTTGAAGATCCCCATGCCTC
TCGTCTGATCGAAGCATTCTCCTTATTAACGGCTCAAATTCGCCGTAATTTAGATGATAATTACCCTCAG
TTGACGGAAGCACTTATTGGTCAGCTCTATCCAGACTACCATGCCACCCTTCCCCCCATGAGCGTGATTA
AATTAAGCGCGAAAGACAATATCAACGTTGGTTTTACGATTGATAAGTCGGAATCGGTTGAACTGGTGGC
GAATCATTTTAAACGTTGCCAGTTTCAAACATGTTATCAAACCTTGTTATGGCCTTTTGACGTCAGTGCG
GCGACGTTTGAAAATGCGCCGTTTCATGCACCAGAAGCCAAGTTTCCGAAAACGGCTTGCTCGGTTTTAA
AGCTTACAGTGACAGGGGCTGATGAGCAGCATGTGCTGTCAGGTTTTGATTTTAATTCTATTCGTTTTTA
TTTGAATGGTTTACCTCATATCAGCTATCAATTATATCAATTTTTACTGCGGTCTGCGGTCGGCATTGCC
ATTGTTCCCAAAGGGAATGAACAAGCGATTAAATATTTATCAGCGAAACACCTTCAAGCAACGGGATTTG
ACGATGATCAAGCGGTTATTCCGTATTCTAAACAAAGCTTTTCAGGTTATCGTTTGTTGGTTGAATATTT
TTTATTGCCAGAGAAATTTCTTTTTATTGAGTTAAATCAGCTTGATTCATCTTGGTTTGGTGATAGTGAT
CAGGCTGATATTTACATCTATTTTGATGAGCCATCAGATGTGATGCCCAAACAGCTGACCAAAGATAATA
TTCTATTGGGCTGCACCCCTATTATTAACTTGTTTGAAAAGCAAGTAGAGCCGATAGCGTTGGATAATGT
GGCTTATGAGTATCCGATCACGCCATCGTATAATCAGTCAGAGGCCAACGAAGTTATTAGTATTGAGCGA
GTAAAAGCTTATAACTGGAATAATACAGAGCTCGATGTTATGCCTTTTTATGGCGGTGAGCATCCGATCT
ACCCTGCGGGAAGTGAATTGTTTTGGAGTATTCGTCGCGAAGACGTTAATTGGGCCGGGGGCTTTGATGA
ACCAGGAAGAGAGACCTATATATCCATTGTTGATCGCAACACCAAGGGGTTTGAGCCAAGTAATAATGAT
CGCTGGAGTTTAAAAATAGAGACCTTATGCAGTAATCGTAATTTGGCATCACGCTTACCCTTTGGTGGTG
GTCAACCCAAAGTCTTTTTGGCAAAACATGGCGATGCGTTTGAAGGCGTTCGCTGTTTATTTGCTCCAAC
AGAACCTGTACGTCCGCGATTGCATGATAGTACGCGCTGGCAGTTATCTAAACTGATCACGCTTAATACG
TTCACCAGCGGTGATAGCCTCTCTACATTGAAAGAAACCCTTAGGCTTTATGATTTTAAAGCCTCGCCAC
AAACAAAAGTGCTAATTGACGCCATTGTCGGTCTTAAGATCAGCCCTGCAACGGCAAGGGTTAATCAAAA
AGGGCGAGTCGGATTTTGCCATGGTTCAGATATTGATCTGACTTTTACTGCCAGTGATGTTCAAGAGCCA
ACGATCTTTCTGTTTAGTCATGTTATTGCTCATTTTTTTGCTCAGTATGCTGCGGTAAACAGTTTTACGC
GGTTACGAGTTTGGCTTAAAGGACAAGAGCAACCTTTTTATGAATGGCCTGCTGCGGCTGGTGGGCAGGT
ACTATTGTGA