SecReT6
Protein ID: 54307875
SecReT6 ID78
T6SS typei5
Gene symbol-
Locus tagPBPRA0672
StrainPhotobacterium profundum SS9
Repliconchromosome I [GenBank: NC_006370] [Browse all T6SS(s) in this replicon]
Location [Strand]739467..740471 [+]
Producthypothetical protein
NoteTssG
UniProt IDQ6LUD2
KEGG IDppr:PBPRA0672
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 1.60E-76, Aligned region: 20..319
Protein Sequence: 334 a.a.     [Download]
>gi|54307875|ref|YP_128895.1| hypothetical protein PBPRA0672 [Photobacterium profundum SS9]
MACCGWWAGTIVMPPLNVDQLNNHDLYEVVFAIERYLMQTGQTLEIGTDALIDNEKVRFQSSQHLGFSAS
EVKVTQQQNEKIVLEVSSLGLTGPAGVLPRHYTELVLQRIKKKDYAFKDFLDLFNHRIISLYYKSWEKYQ
YAVQHQNYLWGKHSDMHEVLKSLTGARYDNDIYWGGLLAKTVRNRSSLEAILSHKLGCSVTVKEFEGRWM
PLKDSEQTALSSSLIPEGQHAKLGHSTVLGKRVWDVNAAIKIVIHAADVELTRRLTQKGELLQAIQHITQ
HFVSSATAISWQVQTAYMHLPTATLKRNTTQLGRSAMLGIRSSLAFQSASISLN
 
Nucleotide Sequence: 1005 bp     [Download]
>gi|54307237|ref|NC_006370.1|:739467-740471 Photobacterium profundum SS9 chromosome 1, complete genome
ATGGCCTGCTGCGGCTGGTGGGCAGGTACTATTGTGATGCCACCACTAAATGTAGATCAGCTTAATAACC
ATGATTTGTATGAGGTCGTTTTTGCGATTGAACGTTATTTGATGCAAACGGGGCAAACGTTAGAAATCGG
TACGGATGCACTTATAGATAATGAGAAAGTTCGGTTTCAATCGTCACAACATCTAGGCTTTTCTGCCAGT
GAAGTCAAAGTGACGCAGCAGCAAAACGAGAAGATTGTATTAGAAGTGAGTTCACTTGGGTTAACAGGCC
CTGCTGGTGTTTTGCCGCGTCATTACACTGAACTTGTTTTGCAGCGCATAAAGAAGAAAGACTATGCGTT
CAAAGATTTTCTAGATCTATTTAACCATCGCATCATCTCGCTTTACTACAAGTCATGGGAAAAATATCAA
TATGCTGTTCAGCACCAGAATTATTTATGGGGTAAGCATAGTGATATGCATGAGGTGCTGAAATCGCTAA
CGGGGGCACGGTACGACAATGATATTTATTGGGGAGGATTGCTCGCAAAGACCGTCCGTAATCGTTCATC
GTTGGAAGCTATTTTATCTCATAAATTGGGGTGTTCAGTAACCGTTAAAGAATTTGAAGGACGTTGGATG
CCGTTAAAAGATAGCGAGCAAACCGCGTTAAGTTCTTCGTTAATACCTGAAGGTCAGCATGCGAAGCTCG
GCCATTCAACAGTGTTAGGGAAACGGGTTTGGGATGTAAATGCTGCGATTAAAATCGTTATTCATGCTGC
CGATGTCGAGTTAACGCGTCGGCTGACCCAGAAAGGAGAGTTACTTCAGGCGATCCAGCATATCACCCAG
CATTTTGTTTCAAGTGCCACGGCTATCAGTTGGCAAGTGCAAACGGCTTATATGCATTTACCTACCGCAA
CATTAAAACGGAACACCACTCAGTTAGGTCGAAGCGCCATGCTGGGTATTCGGTCATCGCTCGCTTTTCA
GTCAGCGAGTATCTCGCTAAATTAA